KEGG   Aspergillus nidulans: AN0089.2
Entry
AN0089.2          CDS       T01016                                 

Name
(RefSeq) RAB7_NEUCR Probable Ras-related protein Rab7
  KO
K07897  Ras-related protein Rab-7A
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
ani04144  Endocytosis
ani04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    AN0089.2
   04145 Phagosome
    AN0089.2
   04138 Autophagy - yeast
    AN0089.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN0089.2
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ani04147]
    AN0089.2
   04031 GTP-binding proteins [BR:ani04031]
    AN0089.2
Membrane trafficking [BR:ani04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab GTPases
    AN0089.2
Exosome [BR:ani04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AN0089.2
  Exosomal proteins of other body fluids (saliva and urine)
   AN0089.2
  Exosomal proteins of colorectal cancer cells
   AN0089.2
  Exosomal proteins of bladder cancer cells
   AN0089.2
GTP-binding proteins [BR:ani04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    AN0089.2
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase PduV-EutP cobW ATP_bind_1 Septin AAA_5 AAA_16 Gtr1_RagA AAA_24 AAA_22 AAA_7 ATPase_2 NACHT TniB NB-ARC SRPRB
Other DBs
NCBI-GeneID: 2875868
NCBI-ProteinID: XP_657693
UniProt: C8VQY7
Position
VIII
AA seq 201 aa
MSSRKKVMLKVIILGDSGVGKTSLMNQYVNKKFSGSYKATIGADFLTKEVLVDDRLIWDT
AGQERFQSLGVAFYRGADCCVLVYDVNNSKSFEALDSWRDEFLIQASPRDPESFPFVVIG
NKIDMEESKRMISSKRAMTFCQSKGNIPYFETSAKEAVNVEQAFEVIARSALAQEEAEEY
GGDYTDPINIHDTTERDGCAC
NT seq 606 nt   +upstreamnt  +downstreamnt
atgtcatcacggaagaaggtcatgctgaaggtgattattctcggagacagtggtgtcggt
aaaacaagtttgatgaaccaatatgtcaacaagaagttcagcggaagctacaaggctaca
atcggtgccgattttcttacaaaggaagttctagtcgatgaccgcctaatctgggatacc
gccgggcaagaacgattccagtcattaggagttgcattctaccggggagctgactgttgt
gtccttgtttacgatgtgaataactccaagagctttgaggcacttgacagctggcgcgac
gagtttctcattcaggctagtccgcgcgaccctgagagtttcccattcgttgttattgga
aacaaaattgatatggaggaaagcaagcggatgatctcttctaagcgagccatgacgttt
tgccagtcgaaaggaaacattccgtatttcgaaactagcgcaaaggaagctgtcaacgtc
gaacaagcttttgaagtcattgctcgaagtgctttggctcaagaagaagctgaagaatac
ggtggcgactacactgatccgatcaacatccacgatactaccgagcgcgacggttgcgcc
tgctga

DBGET integrated database retrieval system