KEGG   Aspergillus nidulans: AN0120.2
Entry
AN0120.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K17606  immunoglobulin-binding protein 1
Organism
ani  Aspergillus nidulans
Pathway
ani04136  Autophagy - other
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN0120.2
   04136 Autophagy - other
    AN0120.2
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ani01009]
    AN0120.2
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN0120.2
Protein phosphatases and associated proteins [BR:ani01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Other PP2-interacting proteins
     AN0120.2
Membrane trafficking [BR:ani04131]
 Autophagy
  Other autophagy associated proteins
   Others
    AN0120.2
SSDB
Motif
Pfam: TAP42 eIF-5a
Other DBs
NCBI-GeneID: 2875897
NCBI-ProteinID: XP_657724
UniProt: Q5BH60
Position
VIII
AA seq 347 aa
MDEPQTLRTVFTDAKRQKTALEARPDTNSDTYRSDVNAAIARFEECQRLVSALSMFSSNE
LLEDISTGDLPYLTIEYHIAELLQKSYSSDRESTLQRALGQYEKFLTRLEDYELLSQKDK
KLYERYVANPSSFSLTQTNDAATRRDVKVTRFREEKELKQKLEKKLQSDDDDLRQLYLAE
IKLYTHQTFQSLDMLAQELSMLSMMKKMPPKPEPSHEVDARGRAKSNDENYSERLDPPIS
QLLKGGKNGPILSKDGKPLQPFTLLDRRTQLRDGVFRSGHNLPTMTIEEYLAEEHRQGNV
LKGGKPEPVEIDEDDMDKADEETMKARAWDEFKEANPRGSGNTLNRG
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggacgagccccaaactcttcgaaccgtgttcaccgacgcgaagcgacaaaagacagca
ctagaagcgcgccccgataccaactccgacacctatcgcagcgatgtcaacgctgcgata
gcaaggttcgaagaatgccagcggctcgtcagcgcactgtccatgtttagctccaatgag
ctactggaggatatctctacaggcgatttaccgtatttaacaatcgagtatcacattgca
gagctccttcaaaagtcctatagctctgaccgcgagtcgacattacaacgagcgctgggt
caatacgagaaatttctaacgcgtcttgaagactatgagcttctgagccaaaaagacaaa
aagctctacgagcgatacgttgcgaatccctcgtcattctcgctgacgcaaacgaacgat
gccgctactcgacgagacgtcaaagtaacgcggttccgagaggagaaggagctcaaacaa
aaacttgagaagaagctccagagcgacgatgatgacttacgacagctctatctcgctgaa
ataaagctatacacacatcaaactttccagtcgctagatatgttagcacaagaattgtcg
atgctgtcgatgatgaagaagatgcctcccaagcctgagccctcgcatgaagtcgacgcg
cgaggaagagctaagagcaatgacgaaaactattcagagcgcttggacccaccgatatct
cagctcctcaaaggaggaaagaatggcccgatactaagcaaggatggaaaacctttacag
cctttcacactcctcgaccgtcgtacgcaacttcgcgatggcgtcttccggtcgggacat
aacctgcccactatgacgattgaagagtacctggcggaagaacatagacaaggaaatgtg
cttaagggaggtaaaccggaaccggttgagattgacgaagatgacatggacaaggccgat
gaagagacaatgaaagcgagggcatgggatgaattcaaagaagcaaacccaagaggctct
ggaaacacattaaatagggggtaa

DBGET integrated database retrieval system