KEGG   Aspergillus nidulans: AN0140.2
Entry
AN0140.2          CDS       T01016                                 

Name
(RefSeq) ARP3_NEUCR Actin-like protein 3
  KO
K18584  actin-related protein 3
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
ani04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    AN0140.2
   04138 Autophagy - yeast
    AN0140.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN0140.2
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ani04812]
    AN0140.2
   04147 Exosome [BR:ani04147]
    AN0140.2
Membrane trafficking [BR:ani04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    AN0140.2
Cytoskeleton proteins [BR:ani04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     AN0140.2
Exosome [BR:ani04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AN0140.2
  Exosomal proteins of other body fluids (saliva and urine)
   AN0140.2
  Exosomal proteins of bladder cancer cells
   AN0140.2
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 2875914
NCBI-ProteinID: XP_657744
UniProt: Q5BH40
Position
VIII
AA seq 446 aa
MANQTPAVVMDNGTGYSKLGFAGNDSPSFVFPTAIATKAGAGSTGGGSRPAVANKPSFLS
SGGGGHLSAKRGTEDLDFFIGDEALAAASGPGYGINYPIRHGQIENWDHMERFWSNSIFK
YLRVEPEDHYFLLTEPCLNNHRLITRQQPMNPPENRESTAEIMFESFNCAGLYIAVQAVL
ALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSSIKSIPIAGRDITYFVQSL
LRDRGEPDSSLKTAERVKEEYCYVSPDIVKEFARYDREPDRFLKHTVTSPNGRSVTIDVG
YERFLAPEIFFNPEIYSSDFLTPLPVVVDGVIQSSPIDVRRGLYKNIVLSGGSTLYKDFG
RRLQRDIRHLVDARIRASEARSGGARSGGLDVAVVTHKRQRHGPWFGGSLLGQTPEFRSY
CHTKAEYDEIGPSIVRRFALLGGPGT
NT seq 1341 nt   +upstreamnt  +downstreamnt
atggcgaaccaaaccccggccgttgtcatggacaacgggactggttattccaagctaggt
ttcgccggtaacgactcgccctctttcgtcttcccaactgcaattgctacaaaggctggt
gctggaagtaccggaggcggttcgcggcccgctgttgccaacaaaccttcattcttgtcc
tctggcggaggtggacatctgtctgcaaagcgcggtacagaggacctagacttctttatc
ggtgacgaagctcttgcggctgccagtggtcctgggtacggcatcaactaccccatccgt
catggacagattgagaattgggatcatatggagcgattctggtcgaactcgatcttcaag
tacctgcgcgtcgagccggaggaccactactttttacttactgagccttgcttgaacaat
caccgattaataactcgccaacagccgatgaacccgccggagaaccgtgagagcaccgcc
gaaatcatgtttgagtcgttcaactgcgccggtctatacattgctgtccaagccgtgctc
gcgttggctgcttcttggacgtcctctaaagtcaccgatcgatcgcttactggaacagtc
attgactctggtgatggtgtcactcacgttattcctgtcgcagaaggctacgtcatcgga
tcttccatcaagagcattccgattgccggtcgagacattacctactttgtacaaagcttg
cttcgtgaccgaggcgagcctgatagcagcctaaagacggcggagagggtgaaagaggaa
tactgttatgtgtcccctgacattgttaaggagtttgcgcgatatgaccgggaaccagat
cgattcctaaagcacactgtgacttcgcccaacggccgtagcgtgaccattgacgttgga
tacgagcggttccttgcacccgagattttttttaatcccgaaatctactcctccgacttt
ttgactccgctccccgttgttgtcgatggagttatccagtcttctccaatcgacgtccga
aggggtctctacaagaacattgtgctttctggtggttccactctttacaaggatttcggc
cgacgtctgcaacgcgatattcgacacttggtcgatgcgcgtattcgcgcttcggaagcc
cgcagcggaggagcacggagtggcggtctggacgttgctgttgtgacgcataagagacag
aggcacggtccatggtttggcggcagtctgctgggtcagactccagaattccgcagctac
tgccataccaaggccgagtacgatgaaatcggtcccagcattgtccggagattcgccctt
cttggtggccctggcacctaa

KEGG   Aspergillus nidulans: AN0306.2
Entry
AN0306.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K05758  actin related protein 2/3 complex, subunit 2
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
ani04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    AN0306.2
   04138 Autophagy - yeast
    AN0306.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN0306.2
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ani04812]
    AN0306.2
Membrane trafficking [BR:ani04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    AN0306.2
Cytoskeleton proteins [BR:ani04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     AN0306.2
SSDB
Motif
Pfam: P34-Arc
Other DBs
NCBI-GeneID: 2876082
NCBI-ProteinID: XP_657910
UniProt: A0A1U8QLU4 Q5BGM4
Position
VIII
AA seq 320 aa
MLLLDYENVLIRSLLTERFSGAPPVSIDQIVSDFDGVTFHLSTPEVKTKILISLNVKCFR
ELVQYGAQQVLEREYGPYIVAPEPGYDFSVLIDLENLPDDQTAREDLITRLALLKRNAMA
APFEKAFDEFAQLAEEASKYTSEAAPAGVAEGGEVMAIHYREEEAIYIKASHDRVTVIFS
TVFREETDRIFGKVFLQEFVDARRRVATLQNAPQVLFRNDPPLELAGVPGLQDAGDGKIS
YITFVLFPRHLTPQRRQENISHIQTFRDYFHYHIKASKAYIHTRMRKRTADFLQVLNRAR
PENEERERKTASGRTFRVQG
NT seq 963 nt   +upstreamnt  +downstreamnt
atgcttctgttggactatgagaatgttcttatccggtcactcctgacggagcggttctct
ggagccccgccggtgtccatcgaccagatcgtctcggatttcgacggtgtcacattccat
ttatcgaccccggaggtcaaaacaaagattctcatctccctcaatgtgaaatgtttccga
gaactggtgcagtatggtgcccaacaggttctggaaagggaatacggcccctacattgtc
gcccccgagccaggctacgacttttccgtcttgatcgacttggagaaccttcccgatgac
caaacagcgcgagaggacctcatcacacgactagctttgctgaagcgcaacgcaatggcc
gctccgttcgagaaggcgttcgatgagttcgcgcagctggcggaggaagcttcaaagtac
acttcggaggctgcgccagcgggtgttgcggagggaggcgaagtcatggcgattcattat
cgggaagaagaggcaatttatatcaaggctagtcatgatcgagtgactgtgatcttcagc
acggtcttcagggaggagacagaccgtattttcggcaaggtcttcctacaagagttcgtc
gatgcccgacgacgtgtagcgaccttgcaaaatgcgcctcaagtccttttccgcaacgac
cctccgctcgaactggctggcgttcctggtctacaggacgctggtgacggcaagatcagt
tacatcacatttgttctcttccctcgtcatttaacaccgcagcgacgtcaagaaaatatc
tcacacatccagaccttccgcgactatttccactaccacatcaaagcatctaaggcatac
atccacactcgaatgcgcaagcgaactgccgactttctccaggtcctcaaccgagcaaga
cctgagaacgaggagcgagaaaggaagacggcgagcggacgcactttccgagttcaggga
tag

KEGG   Aspergillus nidulans: AN0673.2
Entry
AN0673.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K17260  actin-related protein 2
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
ani04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    AN0673.2
   04138 Autophagy - yeast
    AN0673.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN0673.2
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ani04812]
    AN0673.2
   04147 Exosome [BR:ani04147]
    AN0673.2
Membrane trafficking [BR:ani04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    AN0673.2
Cytoskeleton proteins [BR:ani04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     AN0673.2
Exosome [BR:ani04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AN0673.2
  Exosomal proteins of other body fluids (saliva and urine)
   AN0673.2
  Exosomal proteins of bladder cancer cells
   AN0673.2
SSDB
Motif
Pfam: Actin MreB_Mbl
Other DBs
NCBI-GeneID: 2876450
NCBI-ProteinID: XP_658277
UniProt: Q5BFK7
Position
VIII
AA seq 430 aa
MPIVLDGGTGFLKVGYAAQVRLSSPRVSLLSLGLRNDFTLILQNFPEHQFPSIVGRPILR
TEEQAGDIVVKDIMCGDEAAAARSMLQISYPMENGIVKKWDDMQHLWNYTFYDKMKIDPT
GRKILLTEPPMNPLKNREQMAEIMLEHYNFGGVYVAIQAVLALYAQGLSSGVVVDSGDGV
THIIPVYESTVLNHHIRRLDVAGRDVTRNLIALLLRRGYALNRTADFETVRQMKEKLAYV
SCDLELDRKLSEETTVLVESYTLPDGRVIRVGSERFEAPECLFQPHLVDVDQPGMAELLF
NTIQGTDVDVRSSLYKAIVLSGGSSMYPGLPTRLEKELKQLWLTRVLKGDPERLSKFKVR
IEDPPRRRHMVFLGGAVLANLVRSWFPFYCRAHPFTYRIMKQIADKEDMWVTKQEWEEQG
ARALAKLGPR
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgcccattgtgctcgacggaggaacgggtttcctcaaagtcggatatgctgcgcaggta
cgtctgtcaagtcctcgagtttctcttctcagtctagggctccgtaatgactttactctt
attttacagaacttccccgagcaccagttcccttcgatagtggggcggcccatcttgcga
acggaggaacaggctggcgatattgttgtcaaggatatcatgtgcggagatgaagccgct
gccgccagatcgatgctccagatcagctaccctatggaaaatggtatcgtcaagaaatgg
gatgacatgcaacatctatggaactacactttctacgataagatgaagatagatcctacc
ggccgcaagatcctcctcactgagccgcctatgaacccgctgaagaaccgcgaacagatg
gcggagatcatgctggaacactataacttcggcggagtatatgttgctatccaagcggtc
cttgcactatatgctcaaggtctcagcagcggagttgtcgtggactctggtgacggtgtc
acccacatcattcctgtttatgaatctaccgttctaaatcaccacatccgccgactggac
gtcgcaggtcgcgatgtcactcggaacctcatcgcgctgctactccgccgcggttatgcg
ctgaaccgtacagccgacttcgagaccgtgcgccagatgaaggagaagctcgcctatgtg
tcctgcgacctcgaactcgataggaaactctccgaggagaccactgtattagttgaatcc
tacactctcccagacggccgtgtcatccgagtcggtagcgagcggtttgaagcccctgaa
tgtcttttccagccgcacctggtggatgttgaccagcctggtatggctgagttgcttttc
aacaccatccaaggcaccgatgtcgacgtccgctctagtctatataaagccatcgtgctc
agcggagggagcagcatgtaccctggtctaccgacacggctggagaaggaattgaagcag
ctgtggttgacacgagtactcaaaggcgatccagaacggctgagcaaattcaaagtccgc
atcgaggacccaccccgacggaggcacatggtatttttaggaggagctgtgctcgccaat
ctggtacgttcatggttccctttctactgccgagctcatccctttacttaccgtatcatg
aaacagatcgcagacaaggaagacatgtgggttaccaagcaagagtgggaggaacaagga
gcacgcgcgctcgccaaactcggtccaaggtag

KEGG   Aspergillus nidulans: AN4919.2
Entry
AN4919.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K05754  actin related protein 2/3 complex, subunit 5
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
ani04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    AN4919.2
   04138 Autophagy - yeast
    AN4919.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN4919.2
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ani04812]
    AN4919.2
Membrane trafficking [BR:ani04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    AN4919.2
Cytoskeleton proteins [BR:ani04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     AN4919.2
SSDB
Motif
Pfam: P16-Arc
Other DBs
NCBI-GeneID: 2872715
NCBI-ProteinID: XP_662523
UniProt: Q5B3G1
Position
III
AA seq 217 aa
MSTLNYRTINIDALDPDSPQNFPLTTLLPSTLPPPQGSSDAANTATQVRQLLRSGDPAAA
LIHVLDTAPLGGDEGAKQVHLATVIDVLQGIRQGEMGRVLQAVLDGPGGVERGDCLMKYL
YASPHVSFLIREARVQANYMRWFRYKGMAAGGPSNGAQSPRKSVSPQSTGFSQIQARNLG
EGGGGQQMSVLLNWHEKLVELTGTGSIVRVMTDRRTV
NT seq 654 nt   +upstreamnt  +downstreamnt
atgtccacgctaaactatcgcaccataaacatcgacgcccttgacccagactcaccccag
aatttccctcttaccacgcttctcccgtccacccttcctccgccccaaggctcgagcgac
gccgcaaatacagcaacacaggtgcggcaactcctgcgctcgggcgaccccgccgcggcg
ctgattcacgtgcttgacacggcgcccctgggcggcgacgagggcgcgaagcaggtccat
cttgcaacggtcattgatgtcctgcaggggattcggcagggtgagatggggagggttctg
caagctgtgctggatggcccgggcggtgtggagaggggggattgtttgatgaagtacttg
tatgcttctccccatgtctcttttttgattcgtgaagcgagggttcaggctaattatatg
cgctggtttaggtacaagggtatggcggctggagggccaagtaacggtgctcagagtccc
aggaagtcggtgtcgccgcagagcacggggttctcgcagatccaggcgcggaatcttggt
gagggaggtggtgggcaacaaatgagtgtgcttttgaactggcatgagaagctggtcgag
ttgacggggacggggtcgattgtgcgtgtcatgacggaccggaggactgtttag

KEGG   Aspergillus nidulans: AN5778.2
Entry
AN5778.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K05757  actin related protein 2/3 complex, subunit 1A/1B
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
ani04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    AN5778.2
   04138 Autophagy - yeast
    AN5778.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN5778.2
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ani04812]
    AN5778.2
Membrane trafficking [BR:ani04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    AN5778.2
Cytoskeleton proteins [BR:ani04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     AN5778.2
SSDB
Motif
Pfam: WD40 ANAPC4_WD40
Other DBs
NCBI-GeneID: 2872066
NCBI-ProteinID: XP_663382
UniProt: Q5B102 A0A1U8QJU4
Position
V
AA seq 363 aa
MATAEPHHLFHAPIADHSFSSDKSVLAVARENNVELYQKTGSKFSLTDELKGHEKTVTSV
DIAPNSGRIVTCSQDRNAYVWEQTPTGWKPTLVLLRINRAATFVRWSPSEQKFAVGSGAR
VIAVCYFEEENDWWISKHLKKPIRSTITTLAWHPNSVLLAAGSTDSHARVFSSFIKGVDT
RPEPSAWGERLPFNTICGEFLNDSAGWIHGVCFSPSGNALAFTGHDSSVTIVYPSAPEQP
PRAMLNISTRLLPFNSLIWNGENEIIAAGHDCEPYRLRGDENGWQLEGTIENKAGAGAGS
VREESALNMFRQMDLKGQTQADTQLKTVHQNTINTIRVYEDTAGSVHKISTSGVDGRVVI
WTI
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggctaccgccgaacctcaccacctttttcacgctcctattgctgatcattcgttctca
tccgacaaatcagttcttgccgttgcccgagagaacaatgtggagctttaccaaaagaca
ggcagcaagttctccctgaccgatgagctgaagggccacgagaagaccgtcaccagcgtg
gatatcgcacccaactcgggtcgcattgttacttgctcgcaggaccgcaacgcctacgtt
tgggagcagacccccacaggatggaaacccacgctggtactacttcgaatcaaccgggct
gcaacttttgtgcgttggtcgccatctgagcagaagtttgctgttggatctggtgcccgc
gttattgctgtatgctactttgaggaggagaacgactggtggatttccaagcacctgaaa
aaacccattcggagcaccatcaccacactggcttggcatccgaactctgttctccttgca
gcaggctcaactgactctcatgcgagagtcttttccagcttcatcaagggcgtcgatacg
cgcccggagccgagtgcttggggagagagacttccctttaacaccatctgtggcgaattt
ctaaacgactctgccggttggattcacggcgtgtgcttctccccaagtggaaacgcgctt
gcattcaccgggcatgatagcagtgtcactatcgtgtatcctagtgcccccgagcagcct
ccccgcgccatgctgaatatttcgacacgtcttcttccattcaacagtttgatctggaat
ggagagaacgaaattatcgccgctggccatgactgcgagccatatcgccttcgtggagat
gaaaatggttggcaattggagggcactattgagaacaaggcaggagctggcgccggcagt
gtccgcgaagagtctgccctgaacatgttccgtcaaatggacttgaagggacagacgcag
gccgacacgcagctcaagaccgttcatcaaaacaccatcaacacaattagagtctatgag
gataccgctggctccgtgcacaaaataagcacaagcggagttgacggccgtgtcgtcatc
tggaccatctga

KEGG   Aspergillus nidulans: AN8065.2
Entry
AN8065.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K05756  actin related protein 2/3 complex, subunit 3
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
ani04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    AN8065.2
   04138 Autophagy - yeast
    AN8065.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN8065.2
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ani04812]
    AN8065.2
Membrane trafficking [BR:ani04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    AN8065.2
Cytoskeleton proteins [BR:ani04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     AN8065.2
SSDB
Motif
Pfam: P21-Arc
Other DBs
NCBI-GeneID: 2869083
NCBI-ProteinID: XP_681334
UniProt: Q5AUG5
Position
II
AA seq 191 aa
MPAYHSIFLEDRDVPVIGNFPVLPLRTRTRGPAYTLPMLPPGVADIDVQPDNESYDCVDE
ILSLFRANVLFRNFEINGPADRMLIYGTLFITECLGKVKPTMSAREAEKALTNVALDNFA
IPGDASFPLNQAFEPPRDRQDAETLRSYLTQVRQEIASRLLARLYPGGVGPSKLRQFWLS
FTKRKFMGKSF
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcctgcctaccactccatcttcctcgaagatcgggatgtccccgtaataggcaacttt
ccagttctacccctccgcacccgcactcgcggccccgcatacaccctccccatgctaccc
ccgggcgtcgccgacatcgacgtacagccagataatgagtcctacgactgcgtagacgaa
attctgtctctgttccgggcgaatgtcttgttccgaaacttcgagattaatggccccgcc
gaccgcatgctcatctacggcacactgttcatcactgaatgcctggggaaggttaagcct
acgatgtcggctcgtgaggcggagaaggctctaaccaatgttgcgcttgataacttcgct
atccctggtgatgcgtcctttccattgaaccaggcttttgaacctccgcgagatcgccag
gatgctgagacacttcgatcataccttacccaagtgcgacaggagattgcgagccgactg
cttgcgagactataccccggtggtgttggtccttcgaagctgagacagttctggcttagc
ttcacgaagagaaagtttatgggaaagagcttttaa

KEGG   Aspergillus nidulans: AN8698.2
Entry
AN8698.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K05755  actin related protein 2/3 complex, subunit 4
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
ani04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    AN8698.2
   04138 Autophagy - yeast
    AN8698.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN8698.2
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ani04812]
    AN8698.2
Membrane trafficking [BR:ani04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    AN8698.2
Cytoskeleton proteins [BR:ani04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     AN8698.2
SSDB
Motif
Pfam: ARPC4
Other DBs
NCBI-GeneID: 2868492
NCBI-ProteinID: XP_681967
UniProt: Q5ASN2
Position
III
AA seq 170 aa
MRPYLQCVRSSLTAALAISNFASQTSERHNVPEIEAASSPELLLNPLTISRNENEKVLIE
PSVNSVRVSIRIKQADEIEHILVHKFERFLTQRAESFFILRRKPVKGYDISFLITNFHTE
AMLKHKLVDFILQFMEEVDKEISEMKLFLNARARFVAESFLTPVSSVAQR
NT seq 513 nt   +upstreamnt  +downstreamnt
ctgcgtccgtatctacaatgcgtccggtcatcgttgactgccgcgcttgccatatccaac
ttcgcgtcccaaacgtccgagcgacataatgtacctgagatcgaggccgcgagctccccc
gaacttctccttaaccctctgacaatctcacgaaacgagaacgagaaggtcttaatcgaa
cctagtgtgaacagcgtgcgtgtgagcattcggataaaacaggcagatgaaattgagcat
atccttgtccacaagtttgaacgtttcttgacccaacgcgcggaatctttctttatcttg
cgaagaaagcctgtgaagggctacgacatatctttcctcattacgaacttccacacagaa
gccatgcttaagcacaaattggtcgacttcattctccagttcatggaggaggtggataaa
gaaatctctgaaatgaagcttttcctgaatgctcgcgctcgatttgtcgctgagtccttc
ctgacaccggtaagttctgttgcgcagcgttga

DBGET integrated database retrieval system