KEGG   Aspergillus nidulans: AN0156.2
Entry
AN0156.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K00915  inositol-polyphosphate multikinase [EC:2.7.1.140 2.7.1.151]
Organism
ani  Aspergillus nidulans
Pathway
ani00562  Inositol phosphate metabolism
ani01100  Metabolic pathways
ani04070  Phosphatidylinositol signaling system
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AN0156.2
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    AN0156.2
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN0156.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.140  inositol-tetrakisphosphate 5-kinase
     AN0156.2
    2.7.1.151  inositol-polyphosphate multikinase
     AN0156.2
SSDB
Motif
Pfam: IPK
Other DBs
NCBI-GeneID: 2875931
NCBI-ProteinID: XP_657760
UniProt: Q5BH24
Position
VIII
AA seq 535 aa
MLCLSSLALWLAALPFLFVSLCSDSGLFNLRWLCRWSLHEGLVSVRDVFRRIRSAEEFQK
RVRAEVKLRECNLRPVTKAEGCTSPVLRRGYSPTLCTRRSRMPSSSRSDSLKNQKLDNDS
FVAFDHAAAGHDGVRCTLSGSFIAKPCTAQEIAFYESTAAHPTFREFIPTYIGTLSSADQ
KEPAAALTAAAASQQGAIVIPGSDHSTPAETPVTSETVRLSTSTAPSTSEAASDVTWTPS
TSAGKKLDTGLSIVLENVASGFKRPNVLDVKLGARLWADDAIPAKRAKLDAVSKETTSSS
LGFRIAGMKVWTGVNGEADEGSKTNPYITRYQQSAGAKGEVTELDGYKRYDKWYGRSLTA
ENVRSGLETYLAGAKAAGTDRSKLVASRLAAGLRRVQRVLESEESRMYSSSVLIIYEGDT
EAMELALEEERKAKEAPPQDSDQADEDEDDFGGLELQDIANLPAGENGAINITIDAQTAQ
MGDPDEEEDDEEGPKVHDLRLIDFAHASWTPGQGPDENVLTGVRNLARIFEELSN
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgctgtgcctttcctctcttgctctttggcttgcggctcttccttttctttttgtgagc
ctctgcagcgacagtgggctattcaatcttcgctggctctgccgttggtctctccatgaa
gggctagtcagtgtgagggatgtgtttcgacgaatacggtcagcggaagaatttcagaag
cgggtgagagctgaggtgaagctaagagaatgtaacctacgaccagtgacaaaagccgaa
ggatgcaccagtccagttttgcgcaggggatactctccgaccctttgcacaaggcgatcg
aggatgccgtcttcttcgaggtctgacagtttaaaaaaccaaaagctggataatgacagc
ttcgtcgccttcgaccatgccgcggctggacatgacggtgttcggtgtacgctctccggg
tccttcatcgcaaaaccatgtaccgctcaagaaatcgctttctatgaatcaaccgccgcc
caccccacctttcgcgaatttatccctacgtacattggaacgttaagttccgccgatcag
aaagagcccgctgctgccctcactgccgcagctgcttcgcagcagggagctatcgtcatc
ccgggctccgatcactcaacacccgcagaaactccggtcaccagcgaaactgtccgattg
tccacatcaaccgctccgagtacgtctgaagcagcatcagacgtaacatggactccgtcc
acatctgctgggaaaaagctggatacagggttgtctatagtactagaaaatgtcgcgtct
gggttcaagcggccgaatgttctagacgtcaagcttggggcgagactctgggctgacgat
gctatccccgcaaagcgagcgaaattggatgcagtgtccaaggagacgacgagctcttct
cttgggttccgtatcgcagggatgaaagtttggaccggcgtcaatggcgaggccgatgag
gggagcaaaacaaacccttatattacaaggtatcaacaatcagcgggcgccaaaggcgaa
gtgactgagctggacggttataagcgttacgacaagtggtatggtcggtccctcactgcc
gagaacgtcagaagtgggctagaaacatatctcgcaggcgcaaaagccgctggaactgat
agatccaaattggtagccagcagactggcggctgggttgagacgcgtgcaacgggttctt
gaatccgaagagagccgcatgtattcatcgagcgtgctaataatctacgaaggggacaca
gaggcaatggagcttgccctagaggaggaacggaaggcaaaagaagcacctccacaagat
tcagatcaggcggatgaggacgaggatgattttggtggcctcgagctccaggatatagcc
aatttgcccgctggagaaaatggagccataaacataaccattgacgcccagaccgctcag
atgggcgatcccgatgaagaagaagacgatgaggagggaccgaaagtacatgatcttcgt
ctgatcgactttgcgcatgccagctggactcctggccaggggccggacgagaacgtccta
acgggagtgcgtaacttggctcgcatattcgaggaactgtcgaattag

DBGET integrated database retrieval system