KEGG   Aspergillus nidulans: AN0182.2
Entry
AN0182.2          CDS       T01016                                 

Name
(RefSeq) RAS_EMENI RAS-LIKE PROTEIN
  KO
K07827  GTPase KRas
Organism
ani  Aspergillus nidulans
Pathway
ani04113  Meiosis - yeast
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN0182.2
  09143 Cell growth and death
   04113 Meiosis - yeast
    AN0182.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN0182.2
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ani04031]
    AN0182.2
Membrane trafficking [BR:ani04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    AN0182.2
GTP-binding proteins [BR:ani04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    AN0182.2
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 MMR_HSR1_Xtn FeoB_N Ser_hydrolase
Other DBs
NCBI-GeneID: 2875958
NCBI-ProteinID: XP_657786
UniProt: Q12526
Position
VIII
AA seq 212 aa
MASKFLREYKLVVVGGGGVGKSCLTIQLIQSHFVDEYDPTIEDSYRKQCVIDDEVALLDV
LDTAGQEEYSAMREQYMRTGEGFLLVYSITSRQSFEEIMTFQQQILRVKDKDYFPIIVVG
NKCDLDKERVVSEQEGESLARQFGCKFIETSAKSRINVENAFYDLVREIRRYNKEMSNPS
GSGAFGARAPDSKMDVSEPGESAGCCGKCIVM
NT seq 639 nt   +upstreamnt  +downstreamnt
atggcttcaaagtttctacgagagtacaagctggtcgtcgtcggtggtggtggtgttgga
aagtcatgcttgacgattcaattgatccagagccacttcgtggacgaatatgacccaaca
attgaagattcataccgcaagcagtgtgtcattgacgatgaggtcgctctgttggatgtc
ctcgataccgccggacaggaagaatactctgccatgcgcgaacaatatatgcgaacgggc
gaaggcttcctcctggtctactccatcacatcgcgtcaatcctttgaagaaatcatgaca
ttccaacaacaaatcctccgcgttaaggacaaggactacttccctatcattgtcgtcggc
aacaaatgcgatctcgacaaggagcgagtggtatccgaacaagagggcgaatccttggca
cgacagttcggctgcaagttcatcgaaacatccgcgaaatcgcgcatcaatgtcgaaaac
gctttttacgaccttgtgcgtgagatccgccggtacaacaaggagatgtccaacccatct
ggatccggtgcattcggcgcccgcgcccccgacagcaaaatggacgtaagcgagcctggt
gagagcgccggctgctgcgggaaatgtattgttatgtaa

KEGG   Aspergillus nidulans: AN5832.2
Entry
AN5832.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K07827  GTPase KRas
Organism
ani  Aspergillus nidulans
Pathway
ani04113  Meiosis - yeast
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN5832.2
  09143 Cell growth and death
   04113 Meiosis - yeast
    AN5832.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN5832.2
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ani04031]
    AN5832.2
Membrane trafficking [BR:ani04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    AN5832.2
GTP-binding proteins [BR:ani04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    AN5832.2
SSDB
Motif
Pfam: Ras Roc Arf RhoGAP_pG1_pG2 SRPRB AAA_25 Septin
Other DBs
NCBI-GeneID: 2870713
NCBI-ProteinID: XP_663436
UniProt: A0A1U8QYE4 Q5B0U8
Position
I
AA seq 225 aa
MAGKMTLYKLVVLGDGGVGKTALTIQLCLNHFVETYDPTIEDSYRKQVVIDQQSCMLEVL
DTAGQEEYTALRDQWIRDGEGFVLVYSITSRASFSRITKFYNQIKMVKESANSSSPSGAS
YLGSPMSSPSGPPLPVPVMLVGNKSDKAVERAVSAQEGQALAKDLGCEFVEASAKNCINR
MQQQRPQDTRRTTGLGQMRDSGPEYPRTFRPDRPRHRGGIKCQIL
NT seq 678 nt   +upstreamnt  +downstreamnt
atggccggaaaaatgactctctataaattggtggtgctgggagatggtggtgtcgggaag
actgctctcacaattcagttgtgtctaaaccatttcgtcgaaacatacgatccgaccatt
gaagattcgtatcgcaagcaagtcgtcattgatcagcagtcatgcatgttggaggtcctc
gatactgccggccaggaggagtacaccgcactacgcgaccaatggatccgggacggcgag
gggttcgtcctcgtctacagcattacgtcgcgtgcttccttctccagaataacgaagttc
tacaaccaaatcaagatggtcaaggagtctgcgaattccagctcgccgtctggcgccagc
tatctaggctccccgatgagctcgccctcagggccaccacttccagttcccgtaatgctg
gtcggaaacaagagtgacaaagcggttgagcgggcggtttcggcccaggaaggccaggcg
cttgctaaagacctaggatgcgagtttgtcgaggcatccgcgaagaactgcatcaaccgc
atgcaacagcaaagaccccaggacactcgccggacgactggtcttggccagatgcgtgac
tctggccccgagtaccccaggacatttcgccccgaccgccctcgacaccgcggcggtatc
aagtgtcaaatcctgtga

DBGET integrated database retrieval system