KEGG   Aspergillus nidulans: AN0238.2
Entry
AN0238.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K01336  cerevisin [EC:3.4.21.48]
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN0238.2
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ani01002]
    AN0238.2
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ani03110]
    AN0238.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.48  cerevisin
     AN0238.2
Peptidases and inhibitors [BR:ani01002]
 Serine peptidases
  Family S8: subtilisin family
   AN0238.2
Chaperones and folding catalysts [BR:ani03110]
 Intramolecular chaperones
  Subtilisin family
   AN0238.2
SSDB
Motif
Pfam: Peptidase_S8 Inhibitor_I9 Ferritin_2
Other DBs
NCBI-GeneID: 2876016
NCBI-ProteinID: XP_657842
UniProt: Q5BGU2
Position
VIII
AA seq 844 aa
MDGQQIVLARRAVKIEPSYLQRSGCQICGDPSRVPQAPGAWNLGLGSAEDLSHRWTGVLR
PIRRESWFLSFRWSVKFVYIFIAAIMKGIFGLSLLPLLVAASPVVVDSIHNGAAPILSST
NAKEVPDSYIVVFKKHVDPVAASVHHSWVQDIHGQKSGGRADLKKRFLGLEFGFGEEIYD
GLKATFNIAGSLMGYSGHFHEDTIEEIRKHPDIEYIERNSEVHTLEDTDVEKNAPWGLAR
ISHRDRLTFGTFNKYLYASEGGEGVDVYTIDTGINIEHEDFEGRAFWGKTIPNNDADEDG
NGHGTHCSGTIAGKKYGVSKKANIYAVKVLRSSGSGTMADVVQGVEWAVESHLKKAKKGG
NGFKGSVANMSLGGGKSKTLEDAVNAGVEAGVHFAVAAGNDNADACSYSPAAAEKAVTVG
ASTLADERAYFSNYGKCTDIFAPGLNILSTWIGSKSAVNTISGTSMASPHIAGLLAYFVS
LQPSKDSAFAVDFTPEKLKKDIISIATEGVLTDIPADTPNLLAWNGGGSTNYSDIIAKGG
YKSGSHVDSTPFKAGGILAQAILTTIPNVMISEFDPVFSSRCSSSMAASMRFSSLFGGLL
LAGAAIAQNTSCSPKSSDAEVIEYAYALQGLLERYYTSQPINQTFLRDATNGSRVEYYQN
LLGIQRQNRLGVRALQQVGSQIPGFSNPRCDYSIPNATSGEDYVKNAAVLEGSVASAFIG
ATGYTQSPEVSFILARLAAVHTADASWLAAEQRSVVFPSNVSSLVPAYNPEYVLGSGKEP
GRLGQYLQDCVTAPSDPCGQTFFIGPLVGSVGNRSSAAAVPSGSSASITPSISPTAAARR
RFGF
NT seq 2535 nt   +upstreamnt  +downstreamnt
atggatggccagcaaatcgtcttagccaggagggcggtaaagattgaaccgagttattta
caaaggtcaggttgtcaaatttgtggtgacccctcacgagttcctcaagcgcctggtgcc
tggaacttgggtctggggtctgctgaggacctgagtcaccgctggacgggcgtcctccgt
ccgattaggcgtgagtcctggtttctttcatttcgttggtctgtcaagttcgtttacatt
tttatagccgccatcatgaaaggcatcttcggcctttcattgcttccgctgcttgttgca
gcctcgcctgttgttgtcgactcgattcacaacggagccgctcccatcctttcatctaca
aacgctaaggaggtcccggactcttatattgttgtcttcaagaaacacgtagaccctgtt
gccgcctctgttcatcacagttgggtgcaggacatccacgggcagaagagtggtggaagg
gcagacctgaagaagcgtttcctcggcttggaattcggattcggcgaagagatctatgac
ggtctaaaggccaccttcaatatcgcaggatccctcatggggtactcgggacatttccac
gaggatacgatcgaggaaatccgcaaacatcctgacatcgagtacattgagcgaaactcc
gaagtccatacattggaggacacggacgttgagaagaacgccccttggggtttggctcgt
atctcgcatcgggacagactcactttcggtacattcaacaagtacctctacgcttccgag
ggaggtgagggagttgatgtttacactattgatactggtatcaatatcgaacatgaggac
tttgagggccgtgctttctggggcaagactatccctaacaacgacgcggatgaagatggt
aacggtcacggcactcactgctcgggcaccattgccggaaagaagtacggtgtttctaag
aaggccaacatctatgctgttaaggttctcaggtccagtggctctggcaccatggccgac
gttgtccagggtgtcgagtgggctgtcgagtctcatctcaagaaagccaagaagggtggc
aacggcttcaagggcagcgttgctaacatgagccttggcggtggcaagtcgaagaccctt
gaggatgctgtcaatgctggcgttgaagccggtgttcactttgctgtcgctgctggtaac
gacaacgccgatgcgtgcagctactctcccgcagccgctgagaaggcagtgactgtagga
gcttcgacccttgctgacgagcgcgcttacttctccaattatggcaagtgcacagatatc
tttgctcctggcctcaacattctgtcaacttggattggcagcaagtcggcggtcaacacc
atctcgggaacctccatggcttcgcctcacattgccggtctcttggcgtactttgtttcc
cttcaaccgtccaaggactctgctttcgcagtcgatttcactcctgagaagctcaagaag
gatatcatatccattgccactgaaggtgtccttactgacattcctgcggacacccccaac
ctccttgcttggaacggtggtggctccaccaactactctgatatcattgccaagggtggc
tacaagagcggctctcatgtcgactccactcctttcaaggctggaggtatcctcgcccag
gccatccttaccacaattcccaatgtcatgatatcagagtttgacccggtcttcagttcg
cgctgctcgtcatcaatggcggccagcatgcgtttctcttctctattcggcggtctcctg
cttgccggggctgcgatcgcccaaaacacaagctgttctcccaagtcctctgacgccgaa
gtcattgaatacgcgtacgcattgcaaggactgctcgagagatactatacatcccagccg
atcaaccagaccttcctgagggatgccaccaatggctcgagagtggagtactaccagaac
ctcctcggcatccagagacagaaccgtttgggcgtccgcgctttacagcaagtcggctct
caaatccccggcttctcgaacccaagatgtgactactcgatcccgaatgcaactagcgga
gaagattacgtgaagaatgctgctgtactcgagggcagcgttgccagtgccttcattggt
gccactgggtacacccagtccccggaagtctcgtttattcttgcgagactggcagccgtg
catactgcagacgccagctggcttgcggcagagcagaggagcgttgtattcccgtccaac
gtttcctccttggtgcccgcttacaacccggaatacgttcttggttctggcaaggagcct
ggacgacttggccaataccttcaggactgtgtcacggcgccttcggatccgtgtggccag
actttcttcatcggaccgcttgttggtagtgttggtaaccgctcttctgcagctgcggtc
ccttcaggctccagcgcctctatcactccatctatttctcccactgcggcggcgagaagg
cgctttggattctga

DBGET integrated database retrieval system