KEGG   Aspergillus nidulans: AN0576.2
Entry
AN0576.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K08333  phosphoinositide-3-kinase, regulatory subunit 4 [EC:2.7.11.1]
Organism
ani  Aspergillus nidulans
Pathway
ani04136  Autophagy - other
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN0576.2
   04136 Autophagy - other
    AN0576.2
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ani01001]
    AN0576.2
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN0576.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AN0576.2
Protein kinases [BR:ani01001]
 Serine/threonine kinases: Other
  VPS15 family
   AN0576.2
Membrane trafficking [BR:ani04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    AN0576.2
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    AN0576.2
SSDB
Motif
Pfam: Pkinase HEAT WD40 PK_Tyr_Ser-Thr Cnd1 Tti2
Other DBs
NCBI-GeneID: 2876351
NCBI-ProteinID: XP_658180
UniProt: Q5BFV4 A0A1U8QSX4
Position
VIII
AA seq 1599 aa
MGQGYSLTTLSAGSAGIDIPELSDLTYEKSMGGGRFMKSIRARQKNGLVFVKVIMKPYPS
MKLEPYVRAIIRERKLLSDIPNALAYQRILETSTGGYLVRQYIHSSLYDRMSTRPFPEDI
EKKWIAFQLLCALRDCHAVDVFHGDIKTENVLVTAWNWVYLSDFSSSFKPTFLPEDNPAD
FSFYFDTSGRRTCYLAPERFLVANEEPGSRNVNWAMDIFSAGCVIAELFLESPIFTLSQI
YKYRKGEYSPEHSQLAKIEDPEIRALILHMIQLDPESRYSAEEYLNFWKIKAFPEYFYSF
LHQYMSLMTDPSSGRTQVEAGSANRGEADDRIERVYLDFDKISSLLGAHLEPGKDGSLST
TSKLTSGTFPVELDLPRYKYSDRTSTDDGVLIFLTLVVSSLRSTSKSSARIKACDILLAF
AERLSDEAKLDRILPYIMILLNDRTDSVKIAAIRSLARLLEMVQVVSPVNAYLFSEYIFP
RLQPFVPNANSQPSPAVRAAYASCIASLAHSSLRFLDMIQALRSDTRLPALIPAGSEPRW
TEDSTYHNLYDVARIDLLDYFETHTKALLTDTDASVRRAFLGSVSSLCVFFGTIKTNEVI
LSHLNTYLNDRDWILKCAFFEAVVGVAVYVGTTSLEQYILPLMVQSMTDPEEFVVERVLR
SLAAMADLGLFQRPTTWDLLHATVRFLVHPNAWIREAAVSLVVNSTKFLSTADKYSILTP
LVRPFLKVSIVDFSEGDILDALKTPLPKALYDQAFVWASQAEKGFFWKSVGRDGASLGSV
DAAFQKRASKAFSLSAQPKNDEDEQWIAKLRALGLTTEDESKLLALREHIWRVSMRQTKD
HESAGASLNNVVALIDYGVTPQTVFFDKSQNVKARRNHENPVGRPQLTRAEDSKAHTIAD
ALLDASTTIDNNANSRRRHARTKSQAQQEIEAAISTPRPNNIEVLRAEDSPASSPIASSP
SAAPGSRPMSPPSSDAERKLPEGRRSPGQESSSTETDNLSLRRLKAGVQKKSSAISLLNR
RDTAKAYAETGTSSANVFGKIGVPAQRDAISPAPRERKPVDLQTHQYRANHSYAGNDPMI
LRLLDSVFAENYPTDFFDLGPYVKELDTRRPIMKADGDVSKVWKPTGTLVTLFGEHSGPV
NRVVVAPDHSFFITGSDDGTVKVWDTTRLEKNLTPRSRQTYRHSSDAKVRALTFVENTHT
FVSGATDGSIHAVKVGYHNSNGTVRYGKLQLVREYQLSTTDDASPEYAVWMEHFRTDAQS
TLLIATSMCRIIALDMKSMRPVYTLQNPTHHGTPTSFCCDRKHNWLLVGTTHGILDLWDL
RFQVRLKAWGLSGSGPIHRLQLHPTKGHGRWVCVSASGNHGNEIIVWDIEKTKCREVYRA
DSPALGHNHPNQAKGISDKEIARRSPPNLKDYEAWHVEGDRPEGMLSRFGTGTVEPPSGS
PSTGTSSGTGINTFIGGFDCPEDGRDNSTRVGFIISGGCDRKIRFWDLHRPDQSCIISGL
DPISDGTVTGSPRYEVSSPTQSLTFAIEHLPNPGANAGGAKGSGKRSGGGRLPRSTVISL
QQQQLLKSHLDFIQDIAVLRVPYGMIISVDRAGMVYVFQ
NT seq 4800 nt   +upstreamnt  +downstreamnt
atgggtcaaggctactccctcacgaccctctctgcgggttcggcggggatcgatattccc
gagctgtccgacctgacatatgagaaatctatgggtggcggccggttcatgaagagtatt
cgagcaaggcaaaagaatggcttagtctttgtaaaggtaatcatgaagccttacccgagt
atgaagcttgagccatatgtcagagctattatccgggaacgcaagctcttatcagatatt
ccaaatgcgttggcatatcagagaatactcgaaacgagtactgggggttacctcgttcgt
cagtacatccacagctcgctctatgatcgcatgagtactcgaccttttccagaggacatt
gagaagaaatggatcgctttccaactcctctgtgctctcagggattgccatgcggttgat
gtcttccacggtgatatcaagacagaaaatgtcttggtcacggcctggaactgggtgtac
ctctcagatttctcctcttctttcaaacctacctttctcccggaggacaaccctgccgac
ttttcgttctattttgacacatccggacgtcgaacttgctacctggctccggaacggttc
cttgtcgccaacgaggagccagggagtaggaacgtgaactgggccatggacatattcagc
gctggctgtgtcattgccgagttattcttggagtcgcccatattcacactgagtcagatc
tacaagtacagaaaaggtgaatacagtcccgagcatagccagctagccaagattgaagat
cccgaaatacgcgctctgatcctccatatgatccaactcgaccctgaatccagatactcg
gcagaggaatatttgaacttctggaagatcaaggcattccccgaatatttttacagcttt
ctacaccaatacatgtccctcatgaccgacccttcttctggtaggacgcaagttgaggct
gggtcggcaaatcgaggagaagccgatgacaggatagagcgggtttatctggactttgac
aagatatcctctcttttaggtgcgcaccttgagcccggcaaagacgggtccttgagcaca
acttctaagcttacaagcggtaccttccctgtggagcttgacctgccgcgttacaaatac
tcggatcgcacgtcaactgatgacggggtgctgatcttcctgacgcttgttgtatccagt
ctccgcagcacttccaaatcatcagcccgaatcaaagcttgtgatatccttcttgcattc
gcagagaggctatccgacgaagcaaagttagaccgcattctcccgtacatcatgatcctg
ctcaatgaccgaacggactctgtgaagatcgcggcgatacggtctcttgcacggcttttg
gagatggtccaagttgtctcgcccgtcaatgcatatctcttctccgaatacatctttccg
agactacaaccgtttgttccaaacgcaaactcacagcccagtccggctgtacgtgccgcg
tatgcctcgtgtattgcatcgctcgcgcattcttcgcttcgattcctggatatgattcaa
gcattacgctcggacacgcgcctgccagcactgataccagctggctctgagccgagatgg
actgaggattccacataccataatctgtatgacgtagcaaggatagatctccttgactac
tttgaaactcacaccaaagccttgttgacggacaccgatgcttctgttcgccgcgcgttt
ctgggatctgtgtccagtctatgcgtgtttttcggtaccataaagacaaacgaagtaatc
ctaagccatctcaatacatatctaaatgatcgggattggattctcaaatgtgcgttcttc
gaggctgtcgtgggcgttgctgtttatgttggcaccaccagcctggagcagtatattcta
cctctaatggttcagtcaatgacagatccagaggagtttgttgttgaaagagtccttcgc
tcgcttgcggccatggcggaccttggtcttttccagagacccaccacttgggatctttta
cacgccactgtgcgtttcttagtacatccaaacgcctggatccgagaagctgctgtcagc
ctggttgtcaattcaaccaaatttctatccacggccgataagtactccattctcaccccc
ctcgttcgcccgttcttaaaggtgagtatcgtggatttctccgaaggagacatactcgat
gctctgaaaactccactccctaaagccttgtatgaccaagcgtttgtgtgggcatcgcaa
gctgaaaagggatttttctggaagtctgtcggtcgagatggtgcttctctgggtagcgtt
gatgccgcgtttcagaagagggcatcaaaggccttctccctatccgcgcaacctaaaaat
gatgaggacgagcaatggatcgcgaagctgagggcattaggattgaccactgaggacgag
tctaaattgctcgccttgagggagcacatttggagggtctccatgcgtcaaaccaaggat
catgagagcgcaggggcttcgttgaataacgtggttgccttaatcgattatggagttaca
ccccaaacagtgttctttgacaaaagccaaaacgtcaaggcgcgaagaaatcacgagaat
cctgtcgggaggccgcaattaacccgagccgaagatagtaaggcacataccatcgccgac
gcactgcttgatgcctccaccacaatcgacaataatgcaaactcgcgacggcgacatgca
cgcaccaaaagtcaagctcagcaggaaatcgaagccgctatctcgactccgaggccgaac
aatattgaggtacttcgtgcagaagactctcccgcatcttcccctatcgcgtcgtcgcca
agtgcagcgccgggatctcgcccaatgtcgccccctagctctgatgctgagcgcaagcta
ccggaaggtagacggagccctggtcaagagagctcgtcaacggagacggacaaccttagt
ctgaggagattgaaagctggggtgcagaaaaaatcgagtgcgataagtttgctcaatcgc
agggataccgcaaaggcatacgcagaaacagggaccagttcagcgaatgtctttggtaaa
atcggcgttccagcccagagggatgctatatcgcctgctcctcgtgaaaggaagcctgtg
gacctgcagacgcatcagtaccgcgccaatcactcgtacgcagggaacgatcccatgatt
ctcagacttctagactctgtatttgcggagaactatcccacagatttctttgaccttggt
ccctatgtcaaagagttggatactcgacggccgattatgaaagcggacggcgatgtgagc
aaagtctggaaaccaacagggacgctggtgacgctctttggagagcatagtggacctgtg
aaccgagtggtcgttgcaccagatcactcgttcttcatcaccggttccgacgacggcact
gtcaaagtatgggacaccacacgtttggagaagaacctcacacctcggtcacgccaaacg
taccgtcactctagcgacgccaaggtgagggcgttaactttcgttgagaatacccataca
ttcgtcagcggtgccactgatggcagtatccatgctgtcaaagttggataccacaattcc
aacggcacagtgcggtatgggaagctacagcttgtgcgcgagtaccagctatccactaca
gatgatgcgtcgcctgagtacgcagtctggatggaacacttccgcacggacgcacagtca
acactgctcattgcaacgagcatgtgtcgaatcatcgctctagacatgaaatccatgcga
ccggtatacaccttgcagaacccgacccaccacggaacccctacttctttctgctgcgac
cgtaaacacaactggctcctcgtcggtacgacacacggaatccttgacctgtgggatctc
cggttccaggtgcggcttaaggcctggggcctgtcgggctcaggccctattcacaggctg
cagctccatccgaccaaaggccatggccggtgggtgtgcgtctccgcaagtggcaaccat
ggaaacgagatcattgtctgggacattgaaaagaccaagtgccgtgaagtgtaccgggct
gattcacccgcactaggacacaaccacccaaaccaggcaaagggcatttcagacaaagaa
attgccaggcggtccccaccaaatctcaaagactacgaagcctggcacgtcgaaggtgac
cgcccagaaggcatgctcagccgcttcggaacaggaaccgtcgaaccaccatccggttca
ccctcaacgggtacctcatccggaaccggaatcaacaccttcatcggcggatttgattgc
cccgaagatgggagagataatagcacccgcgtcggcttcattatctccggcggctgcgac
cgcaaaatccgattctgggatctgcatcgcccagatcagtcttgtattatcagcggtctg
gatcccatctccgatggaacagttacagggtccccgcggtacgaggtatcctcgcccacg
caatcgctgaccttcgccatcgagcacctacccaaccccggtgccaacgcgggtggtgca
aaagggagtggtaagaggagcggcgggggacggctaccaaggagcacagtgataagcctc
cagcagcagcagcttttgaagagccatctagattttatccaggatattgcagtgctaagg
gtaccgtatgggatgatcataagcgtggatcgggctgggatggtgtatgtttttcagtag

DBGET integrated database retrieval system