KEGG   Aspergillus nidulans: AN0763.2
Entry
AN0763.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K20177  vacuolar protein sorting-associated protein 3
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN0763.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN0763.2
Membrane trafficking [BR:ani04131]
 Endosome - Lysosome transport
  Tethering complex
   CORVET complex
    AN0763.2
SSDB
Motif
Pfam: Vps39_2 Vps39_1
Other DBs
NCBI-GeneID: 2876537
NCBI-ProteinID: XP_658367
UniProt: Q5BFB7 A0A1U8QHT9
Position
VIII
AA seq 1125 aa
MASEEEGINSRKRRKLDPPKATPYIFKPLFDQVPVTADDAAEDVHITCVEYWNDNLYIGT
SAAEILHFVCLPPDPSDSNEPSFILASRLPIHYSQTSSVPTKSGIQQILILPTANKACVL
CNGTATFYMLPELSPAFGGNTQVKNCRWIGGLDLNIGPAEPENPVVMISTHSRLMLVKIG
DGARLVRNIECGTPAEDSSIPDILCRRDAKPRSNRGYASSVCSQITAIKSEFATGRESRS
WTELQFEYAGGDVAAFGTSTVRVERSIKVPDAGAIGVRDAQKISVKGAWQAVADEQKPLP
PLPKQPSTQLRPHILSPTPSEFLLVRGSDESEPGVEYDEDGQTRKFLEVQPWDVDPAEAE
DYKSWVEIPSIQADRTKHVGISHTLSPTQLEIQNLAKLLRMVRLKTPALAVYAPAADPRT
QASIEQLQKEKELFESQELTEASEPKKATDWEAERNAEEAKIAQNIGRTQSSLVLWAGNQ
IWRIVRNPLTTQLNDVLQNAQVVVNDGHTLDRKAVWHVIETVQQTEPRSEAEFLGLSLLK
QKSSLLLFGDLLFMDPTARNDEVIDTTEKALIVGDLDPRIAMILIPLLRTETLQSPQGVW
VHAGLAETAEAYLRKTDEAGMSITGFFDARILDMMKRFLLSWQQKRGYGSISDETYVFDS
VDAALLRLLLAQWDSTTKEQAASLGLRTELNKLVDNWKGNFDHAVSLLESYHRLYALSRL
YQSRKMSGNVLKTWRRIIEGETDAGGEITPAGVEVQMRRYLVKIKDVQLVEEYGSWLAQR
NPQLGIQVFADNSSRVKLDPSDAVALLKERAPNAVQDYLEHLVFSKNYVQYADDLLQYYL
DTVITVLETSPEARASLSESYSTYRALQPPKPTYMNFIKENLPSNPWWQSRMRLLQLLGG
GNTTQFTSAPTPSLNYSIPAVLARIEPFQNELVSESIILDGLQGRHREALRLLTHGLGDY
DAATRYCLFGGPRSTSSTGAPLEFAEMSRQSELFRYLLDEFLQIRDLSERIERTSDLLGR
FAAWFDVREVLDIIPDDWSVEILNGFLAHVFRVLVSESREVRIERALSAGQNLRVAAEYI
SGVEKIGGWVEDEEGLKQLRGGHVQTNAGRETTDSDFGEMVEAGN
NT seq 3378 nt   +upstreamnt  +downstreamnt
atggcgtcggaagaggagggtatcaactcgcgcaagaggcgcaagcttgaccctccgaaa
gccaccccgtatatcttcaagccgctcttcgaccaggtgcccgtgacagccgatgatgcg
gcggaggacgtacatattacttgcgtggagtattggaatgataatttgtatatcggaacg
tccgctgcagagatcctgcatttcgtctgtctcccgcctgacccgtccgactcgaacgaa
ccgtccttcatcctcgcttcgagattacctattcactactctcagacctcctcggttcca
actaagtcaggtatacaacaaatccttatcctacccaccgcgaacaaagcgtgcgttttg
tgcaatggaacggctactttctacatgctgccggagctcagcccggccttcggcggcaac
actcaggtcaaaaattgtcgttggattggaggcttggaccttaatatcggacccgctgag
ccggaaaaccccgttgtgatgatctcgactcacagccgtctcatgttggtgaaaattggt
gatggagctcgtctcgtcaggaacattgaatgtggaacaccagcagaagattcctctatt
cccgatatcctttgccgacgagatgcaaaaccccggtcaaatagaggatatgccagttcc
gtctgctcccaaatcaccgctatcaaaagcgagttcgccaccggacgagagtcccggtca
tggacggagctccagtttgaatacgctggcggggatgttgcagccttcggcacctccacg
gtccgcgtcgaaagatcgatcaaggtccctgacgccggagcaatcggagtccgagacgcc
cagaagatcagtgtcaagggagcgtggcaggctgttgcagatgaacagaaacctctacca
cctctgcctaagcagccttcaacccaactcagacctcatatcctctcgccgaccccgtcc
gagttcctattagtcagaggctctgatgaatcggaaccaggcgttgaatatgacgaagac
ggccaaacaagaaaatttttggaggtacagccttgggatgttgacccagcagaagccgag
gattacaagagttgggtagagataccctcaatacaagctgaccggacaaaacatgtcgga
atcagccacacactcagtcccacacagttggagattcaaaatctggcgaagctgttgcgt
atggttcgcttgaaaactcccgccttagcagtatacgcacctgcagcggacccaagaact
caggcttcgattgagcaactacagaaagagaaagagctgtttgagtcccaggagctgacc
gaggctagtgaacctaagaaggctacagattgggaagccgaacgaaacgccgaagaggcg
aagatagcgcagaacattggcaggacgcagagtagccttgtcttgtgggcagggaatcag
atctggcgcattgtgagaaatccattgaccacgcagctcaacgatgttctgcaaaacgcc
caggtagtagtcaacgatgggcacacccttgataggaaggcggtttggcacgtaattgag
acagttcagcaaaccgaacccaggtcagaagcagaattcctgggcctaagcttactaaag
cagaagtctagccttcttcttttcggcgatcttcttttcatggatcccacagctaggaat
gatgaggttatcgacacgacagagaaagcactcatcgtcggagacttggatccacgcata
gccatgatacttattcctcttttacgtactgagactctgcaaagccctcaaggagtatgg
gttcatgcagggctggcggaaacggcggaggcttacttgcgaaaaaccgacgaagcggga
atgtcgatcacagggttcttcgatgctaggattctggacatgatgaaacgattcctgctc
tcatggcagcagaagcgcggttatggcagtatatcagacgaaacctacgtttttgacagt
gtggatgctgctctcctccgtcttcttcttgcgcaatgggatagtaccacgaaggaacag
gctgcctctttggggctccgtactgagcttaacaagcttgtcgataactggaagggcaac
tttgaccatgcggtctcgctcttggaaagctaccaccgactgtatgccttgagccgactg
taccaaagtcgcaagatgtctgggaacgtcctgaagacctggcggcggatcatcgaaggg
gagacagatgccggtggtgaaataacccccgccggcgtcgaggtacagatgcggcggtac
ttggtcaagattaaagatgtgcagcttgttgaagagtacggctcgtggctcgcccagcgg
aatccccagcttggtatccaagtgttcgcggacaactcaagtcgcgttaaacttgatcca
tctgacgctgtggctcttctcaaggaacgcgcaccgaacgctgtccaggattacttggag
caccttgttttctcaaaaaattatgtacaatatgccgacgacctccttcagtactatctc
gacaccgtgataactgtgctcgaaacctcccctgaagcccgagcttctctgtctgagtcc
tactcaacctaccgtgccctccaaccacccaaacctacctacatgaatttcatcaaagag
aacttaccctcaaatccctggtggcagtcacgaatgcgtcttctccagttgctcggagga
ggcaacaccacccaattcacatctgctcccacacctagcctcaactattcgatccccgcc
gtcctcgctcgtatcgagccctttcagaacgagctagtttccgaatccattattctagac
ggattacaaggtcgacaccgggaggctcttcgtttgctcacccacgggttaggtgattat
gatgccgccacgcggtactgtctatttggtggccctcggagcaccagctccactggtgcc
cctttggagttcgccgaaatgtcccgccaatccgaactattccggtatctactggacgag
tttctgcaaatacgcgatctgtctgagcgaattgaacgcaccagtgaccttctgggacga
ttcgccgcgtggttcgacgttcgtgaagtcctcgacatcatcccagacgattggagcgta
gaaatcctcaatggattcctggcgcatgtgttccgtgtgctggtgtcggagtcacgggaa
gtgaggattgagcgggcgctctcagcaggccagaacctgcgcgtagccgcagagtatatc
tcaggggtggagaagatcgggggctgggttgaggacgaggagggactgaagcagttgcgt
ggagggcacgtgcaaaccaacgccgggcgggaaacgacggatagcgatttcggggagatg
gttgaggctgggaactga

DBGET integrated database retrieval system