KEGG   Aspergillus nidulans: AN1102.2
Entry
AN1102.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K00654  serine palmitoyltransferase [EC:2.3.1.50]
Organism
ani  Aspergillus nidulans
Pathway
ani00600  Sphingolipid metabolism
ani01100  Metabolic pathways
ani04138  Autophagy - yeast
Module
ani_M00094  Ceramide biosynthesis
ani_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    AN1102.2
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN1102.2
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ani01007]
    AN1102.2
Enzymes [BR:ani01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.50  serine C-palmitoyltransferase
     AN1102.2
Amino acid related enzymes [BR:ani01007]
 Aminotransferase (transaminase)
  Class II
   AN1102.2
SSDB
Motif
Pfam: Aminotran_1_2 Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 OKR_DC_1
Other DBs
NCBI-GeneID: 2876879
NCBI-ProteinID: XP_658706
UniProt: A0A1U8QTD6 Q5BEC8
Position
VIII
AA seq 672 aa
MPRRFSNTPPVNDPSNPSSSPSTPGKSGIAVKAPSKTNRLTQFFSTSPRAKAESQTARVA
LQNASGANPPISSASLSLPTISLSTATADNQNMNEPPTTLFQPPSPEEARRLAKQHAQFG
PIGHPSHRYSSRHPGGPFPEPVMDEPPYYYLITTYISYLILIAFGHVRDFFGKRFREENY
RHLKPRNGYAALNSDFDNFYVRRLKLRINDCFERPVTGVPGRYITLIDRATDDHNKNFYL
TGTTTDTLNLSSYNYLGFAQSEGPCADITEETIRKYGITPVSTRAEVGTQDLHVELEELV
ASFVGKEASMVFSMGFGTNANIFPALVGKGDLIISDELNHASIRFGARLSGASIAMFKHN
DMHDLEAKLREAISQGQPRTHRPWKKILVVVEGLYSMEGSMCNLPGLIALKKRYKFYLFV
DEAHSVGAIGPRGRGVCDYFGIDTKEVDILMGTLTKSFGANGGYIAADKVMIDKLRATNS
GMFYGESTSPAVIAQIISALRLIKGELIPGQGEERLQRLAFNSRYLRLGLKRLGFIVYGH
DDSPIIPVLLFNPAKMPAFSHEMLKRKISVVIVGYPATPLVSSRARFCVSAAHTKEDLDR
ILTACDEIGNILQLKFSTGVAGGALPMNDDMAPPPEKEVQWQQKRNPRIVPPRWRIEDVI
RRGVQDVKSPLY
NT seq 2019 nt   +upstreamnt  +downstreamnt
atgccgcgtcgattttcaaacactcctcccgtcaacgacccctccaatccctcgtcttcg
ccctcaacccctggaaagagcggcattgcagtcaaggcaccttccaagaccaaccgcttg
acccagttcttctcgacctcgcctagagccaaggccgagtctcaaactgcgcgagttgct
ctccagaacgccagcggtgccaatccgccgatcagctccgcctcactgtccttaccgact
atctcgctttcgactgcgacggcggacaaccagaatatgaatgaaccgccaaccacgctc
tttcaaccaccgtcaccggaagaggctcgtcgtctggctaagcaacatgcccagttcggt
ccgatcggtcatccgagccaccggtactccagccggcatcccggtggcccctttccggag
cctgtaatggatgagcctccttattactatctcattaccacttatatcagttatctgatt
ctaattgctttcggtcatgttcgtgatttctttggtaaacgttttcgcgaggagaattat
cgtcacctgaagccccggaatggctatgcggctcttaacagtgactttgacaacttttac
gttcgccgcctgaagctacgtatcaatgactgtttcgaacggcccgttactggtgttccc
ggaagatacatcaccttgattgaccgagcgacggatgaccacaacaaaaacttctacctt
accggaactacgaccgacacgctgaatttgagctcgtacaactatcttggttttgcccag
tcagaaggcccttgtgccgatatcaccgaggaaacgattcgcaagtacggcattacccct
gtgagtactcgcgcagaagtcggtacacaggacctgcatgtcgagctcgaggagttggtc
gccagctttgttggcaaagaagcgtctatggtcttctcgatgggcttcggtaccaatgca
aacatcttccctgcgttggttggcaagggtgatttaatcatttctgacgaactcaaccat
gcctccatccggttcggtgcgcgtctttctggagcatctatcgccatgttcaagcacaac
gatatgcatgacttggaagctaaactacgagaggctatcagccaaggtcaaccacgtact
caccgaccatggaagaaaattcttgttgttgttgagggtctttactccatggagggctcg
atgtgtaaccttcccggtcttattgccctgaagaagcgctacaagttctatctcttcgtt
gatgaagcacactcagttggagccatcggtcctcgtggtcggggtgtctgtgattatttc
ggcattgataccaaggaagtggatattctcatgggtactttgaccaaatcgtttggtgcc
aacggagggtacattgccgccgacaaggtgatgattgacaagcttcgggcaaccaactcc
ggcatgttctacggagagtcaacttctccggcagttatcgcgcagattatctcagcacta
cgacttatcaagggtgaacttattcctggccagggcgaggagcgactacagcgtttggcc
ttcaattcccgatatcttcgtctgggcttgaagcgtcttggctttatagtgtacggtcac
gacgattcgccgattatacctgttctcctcttcaaccctgccaaaatgccggctttttcc
catgagatgctgaagcgcaagatttccgtggttattgtcggttatccggcaacgcctttg
gtttcctcgcgtgctcgattttgcgtttcggcggcgcatacaaaagaagaccttgaccga
atcctgacggcttgcgacgagattggcaacatcctgcagcttaaattctcgaccggtgtc
gcaggcggtgcactccccatgaatgacgacatggcgccgcccccagagaaggaagtccag
tggcagcagaagcgaaacccgcgaattgtccctccgcggtggcgcatagaggacgtcatt
aggcgtggtgtccaagatgttaagtcaccactatattag

KEGG   Aspergillus nidulans: AN3728.2
Entry
AN3728.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K00654  serine palmitoyltransferase [EC:2.3.1.50]
Organism
ani  Aspergillus nidulans
Pathway
ani00600  Sphingolipid metabolism
ani01100  Metabolic pathways
ani04138  Autophagy - yeast
Module
ani_M00094  Ceramide biosynthesis
ani_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    AN3728.2
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN3728.2
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ani01007]
    AN3728.2
Enzymes [BR:ani01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.50  serine C-palmitoyltransferase
     AN3728.2
Amino acid related enzymes [BR:ani01007]
 Aminotransferase (transaminase)
  Class II
   AN3728.2
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 2873150
NCBI-ProteinID: XP_661332
UniProt: A0A1U8QRK7 Q5B6V2
Position
II
AA seq 504 aa
MDVQETQRLLSEYLHELANLFHRVPGSAIFLRYVKSSYQNDPIRSAVELFLFLFAVRYLL
APKYSTKPGVVQLSEDEIDDLVDEWTPEPLVGKPTALEEMEIDKRPVIAGPVGPKVRLSN
GRTVMNLGSYNFYNFNTNESIKEKAIQTLRNYGVGPCGPRGFYGTQDVHMKTEADVASYL
GTASCIIYSQAFSTISSVIPAFSKRGDIIVADKGVNFAIRKGIQISRSIVRWYEHNDMED
LERVLAKITKEQARKPLTRRFIITEGLFESYGDMSDLPKIIELKLKYKFRLILDESWSFG
VLGRTGRGITEHQNVDAAEVDMIVGSLAGPLVAGGGFCAGSEEIVHHQRISAAAYTFSAA
LPALLSTTASATINILQNSPETISHLRDLTKAMWAQLDPRSDWVRCTSAPENPILVLVLK
PEVVAAKRLSHEDQQYVLQDVVDECIANGVLITRLKCLDDNFEPKQNVPAALKVCVTTGL
TKKEIEKSGTIIRHAITKVLSKRK
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggatgttcaggagacccagcgtctcctttctgaatatcttcatgagctcgcgaatctt
ttccatcgcgttccgggttcggcaatctttctgcgctatgtgaagtctagctaccagaat
gaccccatccgctcggccgtcgagttgtttctattcctgttcgccgtccgctatttgctc
gccccgaagtattctaccaagcctggtgtcgtccagctttcggaagatgaaattgatgac
ctagtggacgaatggacaccggagccgcttgtgggaaagccaaccgctctggaggaaatg
gagatagataagagaccagttattgccggccccgttggtcctaaagttagactttcaaac
ggtcgaacagtgatgaacctcggttcctacaacttttataacttcaatacgaacgagtct
atcaaggagaaggcaatccagacacttcgcaattacggtgtagggccctgcggcccccga
ggcttctatggtacccaagatgtccacatgaagaccgaggcggatgttgcttcctatctt
ggcacagcgtcgtgtatcatctactcccaagcgttttcgaccatatcaagtgtgattccg
gcattctcgaagcgaggtgatattattgttgcggacaagggcgtgaatttcgccattcgg
aagggtatacagatctcgcggagtatagtccggtggtacgagcataatgatatggaggat
cttgagagggttctggccaagatcaccaaggagcaagcgaggaagcctctcactcgacga
tttatcattactgaaggcttgttcgagtcgtatggtgacatgagtgacttgcctaagatc
attgaactcaagttgaagtacaagttccgactgatcctcgacgaatcatggtcgtttggc
gttctgggaaggacaggacgtggtatcactgaacaccagaacgttgacgcggccgaggtt
gacatgattgtgggctcgctggccggcccattggttgcgggagggggtttctgtgcagga
tcggaggagattgttcaccatcagcgtatctcggccgctgcgtacacgttttcggctgca
ctgcctgcgcttctgtccacgacggctagcgccacaatcaacatcctgcagaacagcccc
gagacaatctcgcacctgagagacctcacaaaggcaatgtgggcgcagcttgaccctcgc
agcgattgggttcgatgtacaagtgcgcccgagaacccgatccttgtcctcgtgttgaaa
cctgaggtggttgctgcgaaaagacttagtcatgaggaccaacaatacgtcctgcaagac
gtagtagatgagtgcatcgcgaacggtgtgctgatcacccgcctcaaatgcctcgatgac
aacttcgaaccaaaacagaatgtccccgctgctctgaaagtatgcgtcacgaccggcttg
acgaagaaggagatcgaaaaatcaggaaccatcatccgtcatgccattaccaaggttttg
agcaaaaggaagtaa

DBGET integrated database retrieval system