KEGG   Aspergillus nidulans: AN1335.2
Entry
AN1335.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K08266  target of rapamycin complex subunit LST8
Organism
ani  Aspergillus nidulans
Pathway
ani04136  Autophagy - other
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN1335.2
   04136 Autophagy - other
    AN1335.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN1335.2
Membrane trafficking [BR:ani04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    AN1335.2
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 PALB2_WD40 eIF2A
Other DBs
NCBI-GeneID: 2877090
NCBI-ProteinID: XP_658939
UniProt: Q5BDP5 A0A1U8QUP2
Position
VIII
AA seq 393 aa
MSVILCTAGYDHTIRFWEALSGICSRTIQHPDSQVNRLCITPDKRYLAAAGHNNVKLYDI
KSTNPNPVMTFEGHTNNITGVAFHCEGKWMVTSSEDGTVKVWDTRTGSLQRNYAHKAPVN
DVVIHPNQGELISGDRAGIVRVWDLGESVCTHQLIPEDDVAVHSVSVASDGSLLCAGNKK
GNVYIWRMIQEAEVTRIVPICTFQAHKDYLTRVLLSPDVKHLATCSADHTAKVWNLDLDF
PPAKTAIAAAARSKVKSPSAAEVKPASPSSAGSESQSNSMQLERGKADSIPFHLLNGTQP
ANNVEPPPSFPVQPDGPPMDPNTGTLFLETTLANHQRWVWDCAFSADSAYLVTVSSDHYA
RLWELASGQIIRQYSGHHRGAVCVALNDYSEPR
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgagtgtcatactttgtactgccggctatgaccataccattcggttctgggaggctcta
tcgggaatctgctcgcggactatccagcaccccgactcccaggtaaaccgtctctgcatc
acaccagacaagcgatatctggcggctgccggtcacaacaatgtgaaattatacgacatc
aagtccacgaatccaaatcctgttatgacattcgaaggtcacacaaacaacattactggc
gtagcatttcactgcgaaggaaagtggatggtgactagctctgaagacggcacagtaaag
gtctgggacaccaggacaggaagcctccagcgcaactacgcacacaaagccccggtgaat
gacgtagtcatacatccaaaccagggcgagctcatcagcggtgaccgtgctggcattgtt
cgggtatgggatcttggagagagtgtctgcacacatcagttgattccggaggacgacgtt
gccgtgcatagcgtcagcgtcgccagcgacggatccttactttgtgctggtaataagaag
ggaaatgtgtatatctggcgcatgatccaagaggccgaagtgactcgaattgtcccaatt
tgcacctttcaagcccacaaggactacctgactcgtgtcctcctttcgcctgacgtcaag
cacctagcaacctgctccgctgaccatactgctaaagtatggaatctcgacctggacttc
cctccagcaaagacggcaattgcagctgccgcccgatcaaaggtcaagtcaccgtctgca
gcagaagtaaaaccggcgtctccgtcttctgcaggctccgaaagtcaaagcaactcaatg
caacttgagcggggcaaagctgatagtattccgttccacctgctcaacgggacgcaacct
gctaacaatgttgagccgccgccatcgtttccagtacagcctgatggccctcccatggat
ccaaatacaggcacattgtttctcgaaacgactcttgcaaatcaccaacgatgggtctgg
gactgtgctttttcggctgattcggcctatctggttactgtgtctagtgaccactatgcg
cgtctttgggaacttgcctcgggtcagataatacgtcagtatagtgggcatcatcgcggg
gcagtgtgtgttgcactaaacgactactcggagcctcgctga

DBGET integrated database retrieval system