KEGG   Aspergillus nidulans: AN1632.2
Entry
AN1632.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K08269  serine/threonine-protein kinase ULK2 [EC:2.7.11.1]
Organism
ani  Aspergillus nidulans
Pathway
ani04136  Autophagy - other
ani04138  Autophagy - yeast
ani04139  Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN1632.2
   04136 Autophagy - other
    AN1632.2
   04139 Mitophagy - yeast
    AN1632.2
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ani01001]
    AN1632.2
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN1632.2
   03029 Mitochondrial biogenesis [BR:ani03029]
    AN1632.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AN1632.2
Protein kinases [BR:ani01001]
 Serine/threonine kinases: Other
  ULK family [OT]
   AN1632.2
Membrane trafficking [BR:ani04131]
 Autophagy
  Autophagosome formation proteins
   Atg1 complex
    AN1632.2
Mitochondrial biogenesis [BR:ani03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    AN1632.2
SSDB
Motif
Pfam: DUF3543 Pkinase PK_Tyr_Ser-Thr Pkinase_fungal BMFP
Other DBs
NCBI-GeneID: 2874875
NCBI-ProteinID: XP_659236
UniProt: Q5BCU8
Position
VII
AA seq 935 aa
MASTPSKSSRSSKEAYSEVAIGPYTRLDHIGKGSFATVYRGVQTKSRTFVAIKSVNLGKL
NRKLKDNLAMEIDILKYLLHPHIVALLDCLETNSHIHLIMEYCALGDLSQFIKRRDSLKD
HSYTRHMISKYPNVSGGALNEVIVRHFLKQLASALRFLRDKNLIHRDIKPQNLLLCPAPK
PAPTQSEAEPQIVPLKGSETSFTPAVGLETLPLLKLADFGFARSLPATSLAETLCGSPLY
MAPEILRYEKYDAKADLWSVGTVLYEMVVGKPPFRATNHVELLRKIETARDRIKFPEENP
ASDDIKALVRGLLKFNPVVRMTFADFFENDIITGPIPGLAAEDVPIPDRPPSPEVIPTES
AEPQSVSDTIYPRNNDAEPKEDRYPPPHRYVPHNDRPQTPTSSSPMRRTRSGDRPSSAKQ
IPPAAAPPRPEAVSHATAPGRQELIGRHSSEQQAPGTVPVYKNVDKLKEERELAAQEVAF
ERDYVVVEKRAVEVNAFADQLAYDPRFHGKQTGALPRRQTTPALPTTQASSQNSPRKAVQ
VVSGRSRADSAHNRHASYERRYGQSPTSATSAISKALNMASGRLFGVGFSPPLNIAKGGR
SPPLAYNPFPAYPTGHAGLLTMGDGARAQASPDEDTRTVKELEECATRSDVVYGFAEVKY
KQLIPLAPSSQSYNSPNAPGTNFEEGELTPDAAVTLSEEALVLYVKALSLLAKSMDIAGA
WWMRKNRAEALGESSFSRLEPVSIRINKVVQWVRSRFNEVLEKAEFVRLKLLEAQRRLPT
DHPSHPNNLSLESAGSGTSVDVMVSPGVTAEKLMYDRALEMSRAAAINELTSEDLPGCEI
AYVTAIRMLEAVLETDEVQPSGKGTDKVTLDGVQGEEREVLLKLVSKIRMRLATLRQKLA
VLAKRQTPPSSGKMIPSNLAHATPATPATGMATPR
NT seq 2808 nt   +upstreamnt  +downstreamnt
atggcttcgacaccatcaaagagctccaggagctcgaaggaggcttatagcgaagtggca
attgggccgtacacgagactggatcatattggaaaaggcagctttgccactgtataccgt
ggtgttcagacgaaatcacgaacgtttgtcgctataaagtcggtaaacctgggaaagctc
aacagaaagctcaaagacaacctagcgatggagattgatatcctcaaataccttctccac
ccgcacatcgtcgcactgctcgactgtcttgagacaaattcacacattcatttgataatg
gaatactgtgctttaggcgatttgtcacagttcatcaaacgaagggacagtctcaaagac
catagctatacccggcatatgatatcaaagtatccgaacgtctctggtggagccttaaac
gaggtgatcgtccgtcatttcctgaagcagctggcaagcgccctaaggttccttcgtgat
aagaaccttattcaccgcgatatcaagcctcaaaatcttttgctctgcccggcgccaaaa
cccgcgccaacgcagtcagaagccgagccacagatagtcccgctcaaaggcagtgaaacg
tcgtttacgccggcggtgggcttagaaacgctgccattgctcaagttagctgatttcggt
ttcgcacgatccctccctgccacgtctctcgcagagacattatgtggttctcctttatat
atggcccctgagattctacggtacgagaagtatgatgccaaggcggacttatggtccgtt
ggcactgtgctatacgaaatggtcgtgggaaaaccgccatttagggcaacaaatcatgtt
gaattgcttcgaaagatcgagactgcaagagaccgaatcaagtttccagaagagaatcct
gcctcagatgatattaaggcactagtccgtggccttctaaaattcaatccggtggtgcga
atgacatttgcagatttctttgagaatgacattattacgggtcctatacctggcctagca
gccgaagatgtacctattcccgatcgcccaccgtcaccagaggtcattcctaccgagtct
gcagagcctcaatctgtttctgacactatctatccccggaataatgacgctgaaccaaaa
gaagaccgttatccgccgccccatcgatatgtacctcacaatgacaggccgcaaacgccc
acaagctcttcacctatgcgaaggaccaggagtggcgacagaccttcctccgcgaagcag
atacctccagctgctgccccaccgcggccggaggcagtttcccatgccacagctccagga
cgtcaggagcttataggtcgccattcttcagaacaacaggcccctggtaccgtgccggtg
tacaaaaacgtagacaagttaaaggaagaacgtgaactagctgcacaagaagtcgcgttc
gagcgagactacgttgttgtggagaagcgcgcagtcgaagttaatgcttttgcagatcaa
ttggcatatgacccaaggttccacggtaaacaaactggtgctcttcctcgaaggcaaaca
acaccagctcttccaacgacgcaggcatcatcgcaaaattctccaagaaaagcagtccag
gtagtatcaggccggtcccgagcggactcggctcacaaccggcatgcctcctacgagcgg
cgctacggccaaagccctacgtctgcgacctcagcaatttccaaggctctcaacatggca
agtgggcgattattcggcgtgggattctctccgccgttgaatatcgccaaaggggggcga
tcgcctcctttggcttacaatccgttccctgcctatccaaccggccatgccggtttattg
accatgggagatggtgctagagcccaagccagcccggacgaggatacacggactgtcaaa
gagctcgaagagtgcgccacccgcagtgacgttgtatatggtttcgccgaggtgaaatac
aaacagcttataccgctagcaccgtcctctcaaagctataatagtccgaatgcgccgggc
actaatttcgaggaaggcgaacttacacctgacgccgccgtgaccctctcggaggaggcc
ttggtactctacgtcaaggcattgtctctacttgccaagtcgatggacattgcgggcgcc
tggtggatgcgcaaaaatcgagccgaagccctgggtgaatctagttttagtcgactggaa
cccgtctcgattcggatcaataaggttgtgcaatgggtccgcagccgattcaacgaggtg
ctcgaaaaggctgagtttgttcggctcaaattgcttgaagcgcagagacgactgccgaca
gatcatccatcccaccccaacaacctctcgctcgagtcagccggttcaggcacctcggtg
gacgtcatggtgagccctggtgtgacggctgagaagctgatgtacgatcgcgcgttggag
atgagccgggcggcggcgatcaatgagctcacgagtgaagatctccctggctgtgagatt
gcttatgtgactgccattaggatgctggaggctgttttggagacagacgaagtgcagccg
tcagggaagggcactgacaaggttacactggacggcgtgcagggcgaggagcgtgaggtc
ttgttgaagttggtgtctaagatacgcatgcggttggcaactttgcgacagaagctggct
gtcttggccaagcgacaaactccgccgtcgagcggaaaaatgatcccctcgaacctagca
catgccacgcctgccacgcctgccacggggatggctactcctcgatga

DBGET integrated database retrieval system