KEGG   Aspergillus nidulans: AN1760.2
Entry
AN1760.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K08336  ubiquitin-like protein ATG12
Organism
ani  Aspergillus nidulans
Pathway
ani04136  Autophagy - other
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN1760.2
   04136 Autophagy - other
    AN1760.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN1760.2
   04121 Ubiquitin system [BR:ani04121]
    AN1760.2
   03029 Mitochondrial biogenesis [BR:ani03029]
    AN1760.2
Membrane trafficking [BR:ani04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    AN1760.2
Ubiquitin system [BR:ani04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   AN1760.2
Mitochondrial biogenesis [BR:ani03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AN1760.2
SSDB
Motif
Pfam: APG12 Ufm1
Other DBs
NCBI-GeneID: 2875179
NCBI-ProteinID: XP_659364
UniProt: Q5BCH0
Position
VII
AA seq 163 aa
MSSPSSRISSINNSPNPNLRKPSSRRESLDQPSNAQNAPIPDDEHGADLPLTMSASVVLT
SLPRDAHQALADAEAIDTGKVTVRFQPLASAPILKNRVFKISASQKFETVVNFLRKKLNC
KDTDSVICYVNSVFAPRLDEGVGGLWRTDDQLIVAYSMTPAFG
NT seq 492 nt   +upstreamnt  +downstreamnt
atgagctctccttcttcacgtatttcctcaattaataactctccgaacccaaacttgcga
aaaccatcgagccggagggaaagtttagaccagccatccaacgcacagaatgcgcctata
ccagacgatgagcatggtgcagacttgccactgaccatgtctgcgtcggtagttttgacc
agtttaccacgcgatgcacaccaagctctggcggatgccgaagctattgatacaggcaaa
gtcactgtccggttccaacccctggcatctgccccgattcttaaaaaccgggttttcaaa
ataagtgcctctcaaaaatttgagaccgtcgtcaatttccttaggaagaagcttaattgc
aaggacacggattcagtaatctgctacgtcaacagtgtttttgctccccgccttgatgaa
ggtgtagggggcctttggagaaccgatgatcaactgattgtcgcttactctatgacaccc
gcatttggctga

DBGET integrated database retrieval system