KEGG   Aspergillus nidulans: AN1867.2
Entry
AN1867.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K06655  negative regulator of the PHO system [EC:2.7.11.22]
Organism
ani  Aspergillus nidulans
Pathway
ani04111  Cell cycle - yeast
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN1867.2
  09143 Cell growth and death
   04111 Cell cycle - yeast
    AN1867.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     AN1867.2
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kinase-like Haspin_kinase Kdo APH
Other DBs
NCBI-GeneID: 2874749
NCBI-ProteinID: XP_659471
UniProt: Q5BC63
Position
VII
AA seq 308 aa
MTRTHPSSFQQLEKLGEGTYATVYKGRNCQTGEMVALKEIHLDSEEGTPSTAIREISLMK
ELHHDNILSLYDVVHTENKLMLVFEYMDQDLKKYMDTHGNHGQLEPAIVKSFAFQLLRGI
AFCHDNRILHRDLKPQNLLINSKGQLKLADFGLARAFGIPVNTFSNEVVTLWYRAPDVLL
GSRTYNTTIDIWSIGCIIAEMFTGRALFPGTTNEDQLQKIFRVMGTPSERTWPGVSQFPE
YKSDFPVYPPQDLRQVVPRIDPYGLDLLRCMLRLQPDLRISAVDALRHPWFNDPVSDLPI
DHGMEALT
NT seq 927 nt   +upstreamnt  +downstreamnt
atgacccgaacccaccccagctcctttcagcagctggaaaagctcggtgaaggaacttat
gccacggtctacaagggccggaattgccaaacaggggagatggtggcgctgaaggagatt
cacctcgactcggaagaagggacgccatctacggcgattcgcgagatttctctaatgaag
gaactgcaccacgataacatcctttcgctatacgacgtcgtgcacaccgagaataagctc
atgctagtattcgagtacatggaccaggacctgaagaaatatatggacacacacggaaat
catggtcaacttgagcccgcgatagtcaagtcattcgcttttcagcttctgcggggtatc
gcgttttgccacgataatcggatactccaccgcgatctcaaaccccagaatctgcttatc
aactccaagggccaactcaaactcgccgatttcggccttgcgcgcgcgttcggaattcca
gtcaacacattctctaatgaggtagttacgctctggtaccgcgcaccagacgtgctcctc
ggcagccgcacctataatacgacaatcgatatctggtcgatcggttgcatcattgcggag
atgttcactgggcgcgcgttgtttccaggcacgacgaatgaggaccagcttcagaagatt
ttccgcgtcatgggcacgccttctgagcgtacttggcctggagtttctcagtttccggaa
tacaaaagtgattttcccgtttaccctcctcaggacctgcgacaagtcgtccctaggatt
gatccatacggtctcgacctactccggtgtatgttgcgccttcaaccggatttacgaatc
agtgccgtcgatgcgctgcgacatccttggtttaatgatccagtttctgatctacctatt
gatcatggtatggaggctctcacttga

DBGET integrated database retrieval system