KEGG   Aspergillus nidulans: AN1973.2
Entry
AN1973.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K08493  vesicle transport through interaction with t-SNAREs 1
Organism
ani  Aspergillus nidulans
Pathway
ani04130  SNARE interactions in vesicular transport
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    AN1973.2
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN1973.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN1973.2
Membrane trafficking [BR:ani04131]
 SNARE
  SNAP-25[N] (Qb)
   Vti1
    AN1973.2
SSDB
Motif
Pfam: V-SNARE V-SNARE_C TBCA SOAR
Other DBs
NCBI-GeneID: 2875268
NCBI-ProteinID: XP_659577
UniProt: Q5BBV7
Position
VII
AA seq 222 aa
MSNPLDTDAGSEMLSSYETELNLVQADLNQKLDQIAELSGEQRNSTIRQAERALEEATEL
LDQMRLEKQNIPSAARSKVNTRFRNYATDIDEAKRKLKSLSDDRKALFGDRYTDDPQDAH
LEQRQQLLSGTERLERSSARLRESQRIALETEGIGANVLADLHQQRETITHTHGMLGQSE
SNVDKSIKTLKGMAPRHRVRAGFGSDSLEHIDFLLTTVVERV
NT seq 669 nt   +upstreamnt  +downstreamnt
atgtcgaaccctctggataccgacgctggctctgagatgctcagtagctatgagacggag
ctcaacctcgtccaagccgatctaaaccagaaactcgatcagatagcagagctgagcggt
gagcaacgcaactcaaccatccgacaggcggaacgcgccctagaggaagcaacagagttg
ttggatcagatgcgcctggagaagcagaatattcctagcgcagcacgatcgaaagttaac
actcggttccgtaactatgcaaccgatattgacgaggccaaacgcaaactcaaatctctc
tccgatgaccgaaaggcgctctttggtgatcgctataccgacgacccacaagatgcacat
ttggagcagagacagcaacttctttccggaacggaacgcttagaacggagttccgctcgg
ctgcgggagagccagcgaattgctttggagacggaaggcattggcgccaatgttttggct
gatttgcatcagcagagagagactattacgcatactcatgggatgttgggacagagcgaa
agtaatgtggacaagagcatcaaaactctgaagggaatggctcctagacatcgggttcga
gcgggctttggatctgattcattggagcatattgactttcttctcacgacagtagtggaa
cgtgtatga

DBGET integrated database retrieval system