KEGG   Aspergillus nidulans: AN2076.2
Entry
AN2076.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K08331  autophagy-related protein 13
Organism
ani  Aspergillus nidulans
Pathway
ani04136  Autophagy - other
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN2076.2
   04136 Autophagy - other
    AN2076.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN2076.2
   03029 Mitochondrial biogenesis [BR:ani03029]
    AN2076.2
Membrane trafficking [BR:ani04131]
 Autophagy
  Autophagosome formation proteins
   ULK complex
    AN2076.2
   Atg1 complex
    AN2076.2
Mitochondrial biogenesis [BR:ani03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    AN2076.2
SSDB
Motif
Pfam: ATG13 DUF6158
Other DBs
NCBI-GeneID: 2874917
NCBI-ProteinID: XP_659680
UniProt: Q5BBK4
Position
VII
AA seq 974 aa
MHQQPRSPAPAASTSSARRSQDYDRRSDSPAFDLRTHTNRGLGIETENDTAEPEQSSQPG
PEAISKVNQIVTNYHTKAALIILHSRVELPPSYAKNSNVPRVNRWFNVELEETDALKDQL
KTWRTCDATDNRPPPMIIETYLDTAGLTNNQTLVALDDNGKRWDVTESLAASQSSRPAKA
SSSRAVDVILERWRVELGDMPGKLPSDLGAILPTVYKKSIILFRSLFTYSKFLPAWKFIK
RNGRSRAHPALRVKYRIFSGHARDLSKQDHLTMPLFEGDTKVVDTYSFGVTDSPAGPFSV
QVTYRTCCDFRVDDSEALLSSQFMGADDEIFQPSLPSGGLDARVTPEVGSAPLTRRTVED
PDLSRAYGSLSTFHHVGPTTGASPISALRAAREARASSPSPPTSSHRNSFAAARASPVGR
AATLANDTNPNVARRPSISFQPFKAPPLSASPSLVDPPLSASPRTTGAGRTSLSDSRHMP
PPSVTTSSRKPPSFGPDNANSSPNSASPRPTPMSRYSSAFSHRRGRPSSGGINKLEDDNS
SGRASATSSGAQPGSGLLAEITGTSSDSIHADDENISEFLKMLDLRKDLLSPSSQTAMDN
HSRRMTAASAALSRFRGMKDSNAALSDSMSSSLLMNRSSATSSKQLSGVPGIAGTSISTA
SSPGGKAISPHTPHTPAIPSRLSSNSIVDNTTTRLHGDNGSPVEEDASDETTTERLPSTV
TAIPIPTSPATIFPSTFRRSSSAANRRSSHAIDDDEIFTMRSVSLGAEEPSHTTLGALQR
QQDYEPIGTNIAPLESGARSSGGDDGNVLRGPTRRGPGAHRDASLSGPTVATSPYSHHPL
HQRRISHSRGRGFSGGPHSLSSGSSSIARGGLIHPYPAEREAERDANAGASHSGTEDRRG
TGRGSGGGRHNLPQAAQVEEDEPLLFAMSDFGASRRSFEEGRQGNHGPDSSGNTGSSRRG
SGKRGTLSGFHLWP
NT seq 2925 nt   +upstreamnt  +downstreamnt
atgcatcaacaaccgcggtcgcccgctccggcggcgtctacctcatcggctcggcggtcc
caggattacgatcgccgttctgattcaccagccttcgaccttcggacgcatacaaataga
gggttgggaattgaaactgagaatgatactgccgaacccgaacaaagctcacagcccgga
ccggaagctatcagcaaggtgaaccagattgtcacgaactatcatacgaaggctgctctc
atcatcctccattcccgtgtcgaacttcccccgtcttatgctaagaactccaacgtacct
cgagtgaatcgctggtttaatgtcgagctggaagagacggatgcgttaaaggatcaactc
aagacctggagaacatgcgatgccacagacaaccgaccgccgccaatgatcatcgagacg
tacttggatacggcagggctcacaaataatcagacacttgtggctttggatgataatggg
aaacgttgggatgtgacggaatcgcttgctgcgtcccagagctcgcgaccggctaaagct
tcttcatccagagcggtagatgtgatattggagcgatggcgagtagaattgggcgatatg
cctggtaaattgcccagtgatcttggcgctatcctgccgacggtatacaagaagagtatc
atcctcttccggtctctctttacatattcaaagtttcttccggcttggaagtttattaaa
cgcaacggtcgatcacgagcacaccctgcgctcagggtcaaatatcggatattcagcggt
catgcccgggatctgtctaaacaggatcacttaactatgcccttgttcgagggcgatacg
aaagtggttgacacttacagctttggcgtcacggattctcctgctggcccgttctctgtg
caagtgacgtataggacatgctgcgacttccgcgtcgacgactctgaggctcttctaagc
tcccagttcatgggagctgacgatgagatcttccaaccgtcgttaccatccgggggtctg
gacgctagagtaacgccggaagttggatcggcaccgctcacaagaagaactgtggaagat
ccagaccttagtcgggcatacggcagcttgtcaactttccaccatgtaggtcctactacc
ggcgcaagccctatctctgcgcttcgagccgccagagaagcaagggcttcctctccatcc
ccgccgacctcatcacatcggaattctttcgcagctgcgagggctagcccagtaggacgc
gctgcgactcttgctaatgacacaaatcccaacgttgctagaaggccctccatctcgttt
cagccgttcaaggcaccgcctttgtccgcgtcgccctccctagttgatcctccactaagt
gcttcacctcggacgactggagccggtcgaacctcactgtctgattctaggcatatgccg
ccaccctcagtgactacttcatcacgcaagccgccctcatttggtcccgataatgctaat
tcatccccgaactcggcatcccctcgtcccacacctatgtcgagatatagtagtgccttc
agtcaccgccgaggtaggccgtcttcaggaggcattaacaagctagaagacgacaactcc
agtggtagagccagtgcaacgtcttctggtgcccagccaggctccgggttacttgccgag
atcacaggaaccagctccgattcaattcacgctgacgatgagaacatttcggaattcctg
aagatgctcgatctcagaaaggatttgctaagcccttcgagccagactgctatggacaat
cattcccggaggatgacagcagcttctgctgctctaagccgttttcggggcatgaaagat
tccaatgccgccctttctgactcgatgtcatcttcgctgctcatgaaccgctcatccgcc
acttccagcaaacaactttctggggttccgggtatagctggtacatccatctctaccgct
tcatctcccggagggaaagcaatatctcctcatactccccatactcccgccataccttct
cggctcagctccaacagtatagtcgataataccaccacacgtttacacggagataacggt
tcgccggtagaagaggatgcaagcgatgagactacgactgaacgtctcccttcaacagtt
accgccataccgattcccacttcgcctgcgaccatcttcccctctactttccgtcgctct
agctcagctgccaaccgtcgaagtagccatgctattgatgatgacgagattttcactatg
cgtagcgtgagtcttggagctgaggagccatctcatactactcttggggcattgcaacgg
caacaggattacgaaccaattgggaccaatatagctccgttagaatctggagcgcgttcc
agcggaggcgatgatggaaatgttcttcgaggccccacacgacgggggccaggcgctcat
cgtgatgcttcgttatcgggcccaaccgtggcaacatccccatattctcaccaccctctg
caccaacggcgtattagccattctcgtggccgcggattctccggcggtccccactctctc
agttccggttccagcagtattgcacgtggtgggcttatccatccctacccagctgagcga
gaggctgagcgcgatgccaatgcaggcgccagccatagcggcacggaagaccgccgagga
actggacgaggatctggcggcggtcgccacaaccttccgcaggccgcccaggttgaagag
gacgagcccttgttattcgccatgagtgactttggtgcatctcggcggagcttcgaggaa
ggccggcagggaaaccacggaccagactcaagtggtaataccgggagctccagacgaggt
agtggaaagcgaggcacgctctctggcttccatctttggccttga

DBGET integrated database retrieval system