KEGG   Aspergillus nidulans: AN2093.2
Entry
AN2093.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K20195  vacuolar fusion protein MON1
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN2093.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN2093.2
Membrane trafficking [BR:ani04131]
 Endosome - Lysosome transport
  Others
   Others
    AN2093.2
SSDB
Motif
Pfam: Fuz_longin_1 Fuz_longin_3 Fuz_longin_2
Other DBs
NCBI-GeneID: 2874637
NCBI-ProteinID: XP_659697
UniProt: Q5BBI7
Position
VII
AA seq 614 aa
MDTKDSNSSQALAIDGGAQTRPTDDHASLTKRLTQPRSDRSQSPEGRPPPLPPRPETLIL
LEDGGAAPGTPRPNVSAVHPGLQSRATTAVSLAEISQNDRGKDALAVRSFPGTVRAKASL
SHLATPKDGSDAGDSASVTSYVPYSESGDVENIFGSLASSEVGIAQEESTGLMQFPEFQA
DDVEDDFASELEPVGEIGEGGENEGTVLAYGSTTAETDQLIDLVLEKWKAKRKHYIILSA
AGKPIWTRHGDGGLISTYVGIIQTIISSYEDSNDRLNGFTAGDTKFTVVAKGPLYLVAIS
RILESDTQLKLQLEALYMQILSTLTLPALTHLFSVRPSTDLKRPLQGSETLLSTLADSFT
KGSPSTLLSALECLKIRKSHRQTINNTLLKTKVSKLLYGLVVAGGRLVSVVRPKKHSLHP
GDLQLLFNMIFEAEAVKAGGGESWIPVCLPGFNSSGYLYIFFELQAMKNALVEKLEENGS
INNIKEAIDKGRPSTTDIVPGSVLHHFVYKSRVNVQFIMSAYDPEFSTITRRRRLISTYN
NLHASVHAKHTHVKVHHCVTQSSSSFAWITPVFELYCVAGPHANRNALAQSASKVVQWVQ
KEEERLFIISGAVF
NT seq 1845 nt   +upstreamnt  +downstreamnt
atggacacgaaagacagcaattcctcgcaagccttggctattgatgggggcgcgcagacc
cgaccaactgatgatcatgcctccttgacaaagcgactcactcaacctcgatctgatcgc
agccagagccccgaaggccgtccaccgccgttacccccgcgtccggagacactgatcctg
ttagaagatggaggggcagctcctgggacaccaagaccgaacgtttcagcagtgcatcca
ggcctgcaatcaagggctactacggccgtatcactggctgagatatcccaaaatgatcga
ggaaaggatgctttggctgttcgctcttttcccggtactgttcgtgcgaaagccagtctc
agccatctagcaacgccgaaggacggaagcgatgctggcgacagcgcaagcgttacaagt
tatgtcccttattccgagtcgggagatgtggaaaatatctttggctctctcgcgtcctcc
gaagtgggaatagctcaagaggaaagtaccggcttgatgcaatttcccgagttccaagcc
gacgatgtggaggacgacttcgcgagtgaactcgagccggtcggcgagatcggcgaggga
ggggagaacgaaggtactgtacttgcttacggttctaccaccgctgagactgaccaattg
atagatctagtacttgagaaatggaaggcgaagcggaagcactacataatactttccgct
gctggaaagccgatctggacaaggcatggcgacggcggtctcatctccacatatgtcggc
attatccaaacaatcatttcatcctacgaagactccaatgaccggttgaacggcttcaca
gctggcgacaccaagtttacagtcgttgcgaaaggccctttatacttggttgccattagt
cgaattcttgaaagtgatacccagctcaagcttcagctcgaggcgttgtatatgcaaatc
ctatccaccttgacgcttccagcgttgacccatctattctccgtgcggccatcgaccgat
ctgaagcgtcccctacaagggtccgagaccctactttcaacattagcagacagcttcact
aagggctcgccatctacattgctttctgccctggagtgcctgaaaatccgcaaatcgcac
cgtcaaaccatcaacaacactctcttaaaaacgaaggtcagcaaactgctatacggtctc
gttgtcgcaggcggtcgtctcgtcagcgtcgtcaggccaaagaagcactcgctgcacccc
ggcgatctccagcttttattcaatatgatattcgaggcggaagccgtcaaagctggcggc
ggcgaaagctggatccctgtatgccttcccgggttcaacagcagtgggtatctatatatc
ttcttcgagttgcaggccatgaagaatgcacttgtagagaaactggaagagaatggcagc
attaataacattaaagaagccattgacaagggccgaccaagtacaacggacatagtccca
gggtcagtcctgcatcactttgtatataaatcccgcgtcaatgtccaattcatcatgtcc
gcgtatgacccggagttctcaaccatcacccgacgccgaagactgatatcaacatataat
aatctccacgcaagcgtccacgccaaacacacccatgtcaaagtccaccactgcgtcact
cagtcctcaagctcctttgcatggataacgccagttttcgaactctactgtgtagctggg
ccgcatgcgaaccggaatgcgctggcgcaaagcgccagcaaggttgtgcaatgggtgcag
aaggaagaagagcggctgtttataattagtggagcggtcttttga

DBGET integrated database retrieval system