KEGG   Aspergillus nidulans: AN2246.2
Entry
AN2246.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K16196  eukaryotic translation initiation factor 2-alpha kinase 4 [EC:2.7.11.1]
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
ani04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ani00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AN2246.2
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN2246.2
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ani01001]
    AN2246.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AN2246.2
Protein kinases [BR:ani01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   AN2246.2
SSDB
Motif
Pfam: HGTP_anticodon2 Pkinase PK_Tyr_Ser-Thr RWD tRNA-synt_His APH Kinase-like FTA2
Other DBs
NCBI-GeneID: 2875639
NCBI-ProteinID: XP_659850
UniProt: A0A1U8QN82 Q5BB34
Position
VII
AA seq 1552 aa
MPHHHKKKTNVLKNSSPKVEKTRVFPDSRPIELPVVAPTNYQEIHQEEVEALRSIYGDDF
EDVQQRRSAWHRSSEVSFRLHLRAPSNADVRLDLLVELPATYPKTCPNITAENLEDLRQG
AQSRIRDVLQNKPRALLGSEMIYELADSIQEILEDAAEAQAHDQDIPSLEEERMVQEAAA
IERAERAKEEELRKQQAASAKEELELKQLVQDAINKRTKALSRRKSRSSGLEAAGDTEGM
ARVPGAITFDPPLVITDADEGPLVFRAVYGKTLLKRVHGASTFIVRPVVPESRPCAPLLV
LKELSINEKGADALAFREQMRLSEDKLESLKRLRHQNLVDFYGFKIQTPLYSGHSEDSTW
TVFALVEHANKGSLSEFLDIVGTVPVEMIRSWTIQLLEALEYYHRHGFVHGNIHCGRVLL
FRNTTGGTIVKLLSSIEEALPDAAGNKRLLMASKSPFWFPPELTQGNSSPTMKTDVWDLG
IVFLQMAFGKDVLQRYTSANALADNLELSPPLHDLLQEFFRPSPKKRPTAFQLQPSEFFR
VDSPLIMRTSASSSMSLSRRPRFESFSGGLPSFSRYHQDFDEAGRLGKGGFGEVVKARNK
LDGRFYAVKKISHKSAAALKDTLSEIMLLSRLNHPYVVRYFTAWLEEDCDQSDEEAISFT
DGYSVGSRRSEEFEYSTTGGLDFISSSGYPNIEFVPDSDEEDAGTISTREKGSSPETFGT
ESGTGKELSRVRSGSHGRPMLTALYIQMEYCEKHTLRDLIKNGLYDDVDRSWRLFRQILD
GLTHIHSNGIIHRDLKPDNIFIDAASNPRIGDFGLATSGQFTTAVRSSAAADFGGNLTRS
LGTTYYVAPEMKSGFAGHYNEKVDDSEKVVQGEIIKSLLSHDPAERPSASELLHSGQIPL
QVEEETFRRAIMHLLSDPSSPDYKKILSAIFSQSPKKVEDIAWDMHSRAPPAANELLMHG
LVKERLTSIFRKHGAVETTRQMLFPKSQHYNSGDVRLLDASGNMLQLPFDLTLPNARAIP
RQDPSLEKTFAFGTVYRDTPHGGEPRTHKEVDFDIVSRNTLDLALKEAEVIKVLDEIIEE
FPPLKASAMCFLINHSDLLQLVMEFCRIKPSQIPLVKEVISRLNVGKYSMQKIRSELRSP
TIGVASTSLDELARFDFRDSPKQTQKRLRAIMEGTEFAERLTPIFARINSLVTFLQGFKI
KRKFFICPLSSLNEKFFRGSILFQCIFDGKRRDVFAAGGRYDSLVQDFRSGVTTNRVQPH
AVGFNLSWDRLSSAMIDYVKAPTKASLKHPETDVGAFWKTRRCDVLVASFDPTILREMGV
QLTQDLWSNSISAELAVDASSLEELLTKYKEHNHSWIVIAKQDSKERGFKVRCLVPKEEL
DIRGSELIPWLRSEIRARNQREGAPENPRFARLPSQSEVNTPANDRSNDVRILVSQHRSK
KTNRRNIVEQALTRAREVVENALNGPIAAIDTRDDLLEAIRDTRLSDPDSWRAVIQNAPL
TERKYLQQVYDLLAEFASESHGDSADYPGNAFIYNFRTGSCLYYDLGSANER
NT seq 4659 nt   +upstreamnt  +downstreamnt
atgcctcaccatcacaagaagaagacaaatgtcctcaagaactcctctccaaaggtggag
aaaacgcgagttttcccggattcaagacctattgaactgccagtagtggctccgacaaat
taccaagaaatacaccaggaggaagttgaggctcttcgctcaatttatggcgacgacttt
gaagatgtgcaacaacggcggtctgcgtggcatcgctcgtcggaagtttcttttagactt
catttgcgagcaccttccaatgccgatgttcgcttagacttgctcgtcgagctgccagcc
acttaccccaagacgtgcccaaatataaccgcagagaatctggaagacctccgacaaggc
gcccagtcgagaatacgcgatgtcctacaaaataagcccagggccctcctgggatccgag
atgatatatgagttggcggattcgatccaggaaatcctagaggatgctgcggaagctcag
gcccatgatcaggatattcccagtttagaggaggaacggatggtacaagaagcagccgca
atcgaacgagcggagcgtgcaaaagaagaagagctccgaaagcaacaagcagcttcagca
aaggaggaactagagctcaagcaactggtacaggatgctatcaataagcgtacgaaagca
ctgtcacgccggaaaagcagatcgtccgggctggaagcagctggcgacactgaggggatg
gcccgtgtaccaggagcaattacctttgatccgccgttggtcataacggacgcagacgag
ggtccattagtgttccgagcggtatatggcaagaccttgttgaaacgtgtacatggagcg
agtacatttatagtgaggcctgtggttccagagagccgaccctgtgcccctctcctagtc
ttgaaggagctgtcaatcaatgaaaagggagctgacgccctagccttccgtgagcaaatg
cggctgagcgaggacaagcttgaaagtcttaagaggcttcggcaccaaaatctagttgac
ttttatggcttcaagatccagacgcccctgtactccggccactcggaagacagtacttgg
acagtattcgctttggttgagcatgcgaacaagggctcgctgtccgagtttctggacata
gttggtacggtaccggttgaaatgattcgtagctggactatacagcttcttgaagcactc
gaatactatcatcgacatggctttgtccacggaaacatccattgtgggcgtgttctgctg
ttcaggaataccacgggtggtacaattgtgaagctgctctcgagtattgaagaagctcta
ccagacgcagctggaaacaaacggcttctcatggcatccaaatctcccttttggtttcca
ccggagctaactcaagggaactcttctccaacgatgaagactgatgtttgggacctcgga
atagtattcctccaaatggccttcggaaaagacgtgcttcaacgatatacttcggccaat
gcactcgcggacaaccttgagttgtcgcccccgctgcatgatttgctacaggagttcttt
aggccaagcccaaaaaagagacccacagcatttcagttgcagccctcggagttctttcgt
gtcgacagtcctttgatcatgcggacgagcgcctcgagttccatgtcattatcgcggcgt
ccgcgctttgaatcctttagcggcggcctcccttcattttcacgctatcaccaggatttc
gacgaagctggacgcttaggtaaaggtggctttggtgaggttgtcaaagcacgcaacaag
ctcgacggtcgtttttatgctgtcaagaaaatctcacataaatccgccgctgcattgaaa
gatactttatcagaaatcatgctgttgtcgcgcctgaatcacccatatgtggtacgctac
ttcaccgcttggcttgaggaggattgtgatcagagtgacgaggaagcaatctcattcaca
gacgggtattccgttggtagcagacgttcggaggaattcgagtacagtactacaggcggt
cttgatttcattagttcgagcggctacccaaacatagagtttgtgccggacagtgatgaa
gaggacgccggaacgatatctactagagaaaagggctcatcgcctgaaacctttggcacc
gagagtggcacgggcaaagaacttagccgcgtcaggtcgggctcgcatggccggccaatg
ctcactgcgctatacattcagatggagtactgcgagaaacacacgcttcgagatcttata
aaaaatggcctctatgacgatgtcgacagatcctggcgtttgttccgccagatcctcgat
ggattgactcatattcacagtaatggcattatccaccgcgacctcaagcccgacaatata
ttcatagatgcagctagcaatccgcgtattggagattttggtctagccacgagcggccag
ttcacaaccgctgtacgctcctccgcagcggcagatttcggaggcaacctcactcgaagc
ctgggtacaacttattacgtggcaccagaaatgaaatccggtttcgcgggacactacaat
gagaaggtcgatgattccgagaaagtagttcagggggagatcatcaagtcgcttctaagt
catgatccagccgaacgaccatctgcgtcagaattgctccatagcggtcagattccactt
caggtcgaggaggagactttcagacgcgcaatcatgcatctgctctctgatcctagctct
cccgactacaagaagatcctctccgctatattttctcaatctccaaaaaaggtcgaggat
attgcctgggacatgcattcacgtgccccaccggcagcgaacgagcttctcatgcacggt
cttgtcaaagaaaggcttacatcgatcttccgcaagcacggtgccgtggagactacaaga
cagatgctgtttccgaaatcccaacattacaacagcggcgacgtaaggcttctggacgca
tctggtaatatgcttcaattacccttcgatctaacgctcccgaacgcacgtgcaattccc
cggcaagacccttcactcgaaaagacctttgcttttggtactgtctacagggatacacct
cacggtggtgaaccaagaactcataaagaagtggatttcgacattgtgtctcgcaatacc
ttagacctggccttaaaggaagcagaggtgattaaagttcttgacgagatcattgaagaa
tttccaccattgaaggccagcgctatgtgtttcctgataaaccattcggacttgcttcag
ctagttatggagttttgccgcatcaaaccttcccagattcccttggttaaggaggttatc
agtaggctgaatgtcggcaaatattccatgcaaaagattcgaagtgaacttcgctcaccc
acaattggggttgcttccacctcgctagacgaacttgccaggtttgattttagagactcg
cccaagcaaacgcaaaagcgcttacgggcaataatggaaggcactgagttcgccgagcga
ttaacgccaatatttgcaagaatcaattccctagttactttcttgcagggctttaagatc
aagcggaaattctttatctgtcctctaagtagtttgaacgaaaagttctttcgagggagc
atactcttccaatgcatatttgacggcaaacgacgcgatgtctttgcagccggtggtcgt
tatgactccttggtgcaggatttccgctcaggcgtcacgacaaaccgtgttcagcctcat
gcagtaggctttaatctaagttgggacaggctcagttctgcgatgatcgactacgtcaaa
gctccgactaaggcatcccttaagcatccggaaaccgacgttggggcgttctggaagacg
agaaggtgtgatgtacttgtggctagctttgacccaacaatcctacgcgagatgggtgtg
cagttgactcaagatctctggtccaacagtattagtgccgaattggcagtggatgcatcc
tctttagaagagcttcttacgaagtacaaagaacacaatcatagctggattgtcattgca
aagcaggacagcaaagagcgaggtttcaaagtcaggtgtcttgtgccgaaggaagaatta
gatatacgcggctctgagcttataccttggcttcgaagcgagatacgtgcgcggaaccaa
cgggagggagctccagagaatccgcggtttgctcggctcccaagtcagtctgaagtgaac
acgcctgcaaacgatcgatccaatgatgtgcgcattctcgtatcacaacatagaagcaaa
aagacaaaccggaggaatattgtcgagcaagctcttacccgcgcgcgagaggttgtcgaa
aatgctttgaacggtccaattgcagccatcgatactcgagacgatttgcttgaagccata
agggatacccgcctgtctgacccggacagctggcgcgcggtcatacaaaacgcgcctctc
accgagcgcaagtacctgcaacaagtctacgatctgcttgctgaatttgcgagtgaaagc
catggggatagcgccgattatcccgggaatgctttcatctacaacttcagaacgggttcg
tgtttgtattacgatctagggagtgccaacgaacgatga

DBGET integrated database retrieval system