KEGG   Aspergillus nidulans: AN2266.2
Entry
AN2266.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K20181  vacuolar protein sorting-associated protein 18
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN2266.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN2266.2
Membrane trafficking [BR:ani04131]
 Endosome - Lysosome transport
  Tethering complex
   CORVET complex
    AN2266.2
   Hops complex
    AN2266.2
SSDB
Motif
Pfam: Pep3_Vps18 Clathrin Zn_ribbon_17 zf-RING_5 DUF2175 zf-RING_11 Vps39_2 zf-C3HC4_2 zf-rbx1 zf-RING_UBOX zf-RING_2
Other DBs
NCBI-GeneID: 2875194
NCBI-ProteinID: XP_659870
UniProt: G5EAW8 A0A1U8QJW2
Position
VII
AA seq 963 aa
MALDTSSGYAAHSSLIEPDPLPMFDVRHVQLQFPLAADFVAAQVADNVLILALSTGRILR
IDLNNPEHIDDVDLPKKSSETGVIRRMFLDPSASHLIITTTLGENYYLHTQSRHPKPLSR
LKGLLIESVAWSPSLPTASTREILLGTTDGQVWETYIEPSTEFYRREERYASSIYRTSDG
SPVTGIWAETVPTKAEQRRILVATHGKLSCFLGRTGRSGKEGAGPIYADLLSRETPVIHE
IGQPSSSAPSNLVVSPSSSDAHHLDGHRDKEFAWLSSEGVYHGQLPYSLDMLHKPFESSS
MLPRSIFPATESARGGKKLIQNPLTAMTLSEWHILVLVEGRVLAVNRMNDEIVFDQEVLE
PGQAALGLVTDAMKGTYWLFTSQDIFEICVQDEDRDVWKIFLRKQKFEEALRYARTSSQK
DAVSTASGDFLASKGRYIEAAGVWGKSSKAFEDVCLTLIKRGQHDALRKYLLSQLSVYKK
SSSMQRTMVASWLIEVFMTKLNSLDDNITTKAELAEGSSTEEIEHELQAVRNEFQEFVTK
YKSDLDQKTAYDIISSHGREKELLFFATVVNDHNYVLSYWIQRENWSEALNVLQRQSDPE
VFYKHSSVLMTHAATGLVNILMRQTNLEPEKLIPALLNYNSTVSVPLSQNQAVRYLNFII
VNHPRPTAAVHNTLISIHASSRSSSEAGLLTYLQSQPSSPPPYDADFALRLCIQHQRFQS
CIHIYSAMGQYLQAVELALQHDDIELAAIIADRPEGNNKLRKKLWLLVAEKKIRQSDTGI
KDAIEFLRRCELLRIEDLIPFFPDFVVIDDFKDEICSALEDYSRHIDALRQEMDSSAQTA
RQIRSEIAALDTRYAIVEPGEKCWTCSLPVLSRQFFVFPCQHAFHSDCLGREVLEGAGGK
KKYIRDLQSQLNEGALTSSQREEVVKELDGLIAEACILCGDHAIKQIDKPFITATDNVDE
WCL
NT seq 2892 nt   +upstreamnt  +downstreamnt
atggcgctggatacatccagcggatatgccgctcacagcagcctgattgaaccagatccg
cttcctatgttcgacgtcaggcatgtccagcttcagttccctctcgctgccgactttgtg
gccgcgcaggtagccgacaatgtacttattctggcactatcgactgggcgcattttgcgg
atcgacttgaacaaccctgagcatattgacgatgttgatcttccgaagaagtcttcagaa
acgggtgttatacgtcggatgttcttagacccttccgcttcccatctcataatcaccacg
accctgggtgagaactactacctccacacgcagtcaagacatccaaagcctttatcgcgc
ctcaaaggacttctcatcgagagtgtcgcatggagtccctcccttccgacagcatctacc
cgagagatattattaggcacgactgatggccaggtctgggaaacgtatattgagccatct
actgagttctaccgccgcgaggagagatatgccagctcgatatacagaacgtcggatggg
tctccagtgacgggtatatgggcggagacggtgccgacaaaagcagaacaaagacggata
ttggtggctacgcatggcaaactatcgtgtttcttggggcgaaccggtagatccggtaaa
gaaggtgcgggtcctatatacgccgacctgctttcacgagaaactcccgttatccacgag
attggacagccgtctagttccgcgccgtcaaatttggttgtttcgccatctagctcggat
gctcaccatctagatggtcatcgtgacaaagagtttgcatggcttagttctgaaggtgta
taccatggacaacttccatattcattagacatgttgcacaagcccttcgagagctcaagt
atgcttccgcggtctattttcccggcaaccgaatccgcaagaggaggcaagaagctgatt
cagaacccactaaccgccatgacgttatcagagtggcacatactagtcctggtagaaggg
cgagtgcttgctgtcaatcgcatgaacgatgaaattgtatttgatcaagaggtcctggag
ccaggccaagctgctctgggtcttgtgacagacgcaatgaaaggcacttactggcttttc
accagtcaggacatttttgagatatgtgtccaggatgaggaccgagacgtgtggaaaatc
ttcttgcgcaagcaaaagtttgaggaggctcttcgatatgcccgtacaagctcccagaaa
gatgctgtttctactgcttccggcgatttcctcgcgagcaaaggtcgctatatagaagcc
gccggggtttggggcaagagcagtaaagcatttgaagatgtgtgtctaacactcatcaag
cgtggccagcacgacgccctacgaaagtacctgctttcgcagctctcggtttataaaaag
tcctcctcgatgcaaaggaccatggtggcaagttggcttatagaagtctttatgaccaag
ctgaatagtcttgacgacaatatcacaacgaaagcggaacttgccgaggggtcaagcact
gaagagatcgagcacgaactgcaggccgttcgaaatgagtttcaagagtttgtgaccaaa
tacaagtctgacctggatcagaagacagcatacgacatcatcagcagtcatggacgtgag
aaggaattgttattctttgccactgtggtaaacgatcacaactacgttctgtcgtactgg
atccaacgggaaaactggtccgaagcgctcaatgtgctgcagaggcagagtgaccctgaa
gtgttctacaaacacagcagtgtcttgatgactcacgcagcgaccggactagtcaacatc
ttgatgcgacagaccaaccttgagcccgagaagctcatacctgcgttgctcaactataac
agcacagtgagcgtgccgctgagtcaaaaccaagcggtgcgttatcttaactttatcatc
gtcaaccaccctagacccacggctgcagtgcataacacgctcatatcaattcatgcttca
agccgctcgtcctctgaagctggacttcttacataccttcagtcacagccatcatccccg
cctccatatgatgccgactttgcgcttcgcctttgcatacaacaccagcggttccagtca
tgtatccatatttacagcgctatgggacagtatctccaggctgttgagctggctttacag
cacgatgacattgagctggcggccatcattgctgaccgaccagaaggaaacaataagcta
cggaagaagctttggctcttggttgcggagaaaaaaatccggcaatcagacacaggcatc
aaagacgctatcgagtttcttcgtagatgcgagctgcttcggattgaggatctcatccca
tttttcccggacttcgttgtcattgacgacttcaaagatgaaatctgcagtgccctagag
gactactcccggcacattgatgcgctccgacaggagatggacagctcggcccaaaccgcg
cgccagatccggtcggaaatcgccgccctcgacacacggtacgcgattgttgagcctggc
gagaagtgctggacttgctcgcttccagtacttagccggcagttcttcgttttcccatgt
cagcacgcgttccacagcgattgcctaggtcgtgaggtgctcgagggcgccggagggaag
aagaagtatatacgagatctacagtctcagctgaatgaaggcgcactcacctcgtcccag
cgtgaggaggttgtgaaggaactggacgggttgatagcggaagcttgtatcctatgcggt
gaccacgcgatcaaacaaatcgacaagcctttcataactgcaaccgacaatgtcgatgaa
tggtgcctctaa

DBGET integrated database retrieval system