KEGG   Aspergillus nidulans: AN2418.2
Entry
AN2418.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K20182  vacuolar protein sorting-associated protein 33A
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN2418.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN2418.2
Membrane trafficking [BR:ani04131]
 Endosome - Lysosome transport
  Tethering complex
   CORVET complex
    AN2418.2
   Hops complex
    AN2418.2
SSDB
Motif
Pfam: Sec1 Peptidase_C10
Other DBs
NCBI-GeneID: 2874859
NCBI-ProteinID: XP_660022
UniProt: G5EB82 A0A1U8QZA7
Position
VII
AA seq 655 aa
MAPFPGSDADNIKDKARKGLLNLLEGVRGKKNLVISQGLAGPVGLFVKFSQLQEYGVDRV
FLLENGNVDSSQRNVVFLAYAEKIRQVRAVAEQIQRLQRNSSIDHEFSIFWVPRRTLVSN
NILESAGIIGDVSIAELPLYFFPLEQDVLSLELDDSFADLYLHKDPGCIFHSAKALMAIQ
QRHGYFPRIVGKGDHARRLADLLLRMRKEIDAEESSGLTGLSFRGLLPSSSIESLIIIDR
EVDFGTPLLTQLTYEGLIDELVGIKHNQADIDTTIAGASSTPQAQESSKASQQAKQGQKR
KIQLDSSDQLFSQLRDANFAIVGDILNKVARRLETDYESRHTAKTTTELREFVNKLPSYQ
LEHQSLRVHTNLAEEIMKNTRSDTFRKILEVQQNDAAGADPTYQHPLIEELIARDIPLKT
ILRLLCLESCMSGGLRPKDLESFKRQVVHAYGHQHLLTFSALEKMELLQPRSSATTMLIP
GTGTQTGSKTNYAYFRKNLRLVVEEVSEKEPEDIAYVYSGFAPLSIRLVQCVLQKSYVMS
LMKGGPAAHANTASPGWLGYEDVVKSARGSTFSIVQKGDDKAVRARQTLSGNNAAKTVYV
FFLGGITFTEIAALRFIAAQEAPRRNIVICTTGIINGDRMMDAALEKGGFALTES
NT seq 1968 nt   +upstreamnt  +downstreamnt
atggcaccattccctgggtctgatgccgacaatatcaaggacaaggcccgtaaaggcttg
ctgaatcttctcgaaggcgtccgtgggaagaagaacctggtgattagccaggggcttgct
gggcccgtcgggctttttgtcaagttttcgcagcttcaggagtatggcgtagaccgggta
ttcttgcttgaaaatggaaatgtcgactcttctcagcgcaatgtggtatttctagcgtac
gccgaaaagatccgccaggtgcgggcagtggcagagcagatccaaaggcttcaacgcaac
agcagtatagaccatgaattttccatcttttgggttccaagacggaccctcgtaagcaat
aacatcctagagagcgcaggcatcattggagatgtgagcatcgctgagctgcctctttac
ttttttcctctagagcaggacgttctttctttggaactggatgactcttttgcggacttg
tacctgcacaaggatcctgggtgcatcttccattccgcaaaggctcttatggctattcaa
cagagacatggctattttcctcggatagtaggcaaaggcgatcatgctcgacgactcgct
gacctcctgctgcggatgaggaaggagattgacgcagaggaaagctcaggactgacagga
ctgtctttccggggacttttacccagctcaagcattgagagtttgatcatcattgaccga
gaggtggacttcggcacccctctgcttacacagctaacgtatgagggtctcatcgatgag
ttggtaggaatcaagcacaaccaagcggacattgatacgacaattgcaggggccagctca
actccccaggcccaggagtcttccaaagcatctcaacaggctaagcaaggtcaaaagcgg
aagattcagttggattcgtctgaccaactgttcagtcaactccgtgacgcgaattttgct
atagtcggcgatatcctgaataaggtagcacgtcgattagaaacagattatgagagccgt
catacagcaaaaacgacaactgaacttcgcgagtttgtgaataaactaccatcatatcaa
ctcgaacatcaaagcttgagagttcacaccaacctcgctgaggaaatcatgaaaaacacg
cgctcagacactttccgcaagatcctcgaagtgcaacagaacgacgctgcaggcgccgac
ccaacttaccaacatcctctcattgaggaactcatcgcccgggatattccactgaagaca
atcctccgtttgctttgtctcgaatcatgcatgtccggtggcctacggcctaaagacctc
gagagttttaaacgccaagtcgtccacgcatacgggcaccaacacctgctaacattcagt
gctttggagaagatggagcttctccagccccggtcgtctgcaaccacaatgctaattccc
ggcacgggcacccaaacgggatcgaaaacaaactacgcctactttcgcaaaaatcttcgc
ctggtcgtcgaagaagttagcgagaaggaacctgaagatatcgcttatgtctacagcggt
ttcgcccctctcagcattcgccttgtgcagtgcgtcttgcagaaatcatacgtcatgtcg
cttatgaaaggtggcccggctgcgcacgcgaataccgcatccccaggctggcttggatat
gaagatgtggtgaagagtgcgcgtggatcgacgttcagtattgtccaaaagggcgacgat
aaagcggttcgtgcgcggcagacactgagtggtaacaatgcggctaagaccgtgtatgtg
ttcttcctcggagggatcacatttacggaaatcgcggcattgcggttcattgcggcacag
gaggcgccgaggcggaacattgtgatttgtactacgggaatcattaatggagatcggatg
atggatgctgcgcttgagaagggggggtttgccttgactgagtcttga

DBGET integrated database retrieval system