KEGG   Aspergillus nidulans: AN2461.2
Entry
AN2461.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K20179  vacuolar protein sorting-associated protein 11
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN2461.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN2461.2
Membrane trafficking [BR:ani04131]
 Endosome - Lysosome transport
  Tethering complex
   CORVET complex
    AN2461.2
   Hops complex
    AN2461.2
SSDB
Motif
Pfam: Clathrin TPR_11 TPR_14 TPR_2 TPR_16 TPR_12
Other DBs
NCBI-GeneID: 2875403
NCBI-ProteinID: XP_660065
UniProt: A0A1U8QPP9 Q5BAG9
Position
VII
AA seq 1464 aa
MALTSWKAFNFFDVSPVKLPEDSASLFNSETSCLCSGSANLFLGTTDGFVHTISSSFKVV
QSFKASDNGSITHIKQLEGTSLLVTIAEDLLNEPVLKVWALDNPEKKTGIPRCLSTTPVQ
NARRLFPVSAFAALGDLSQVAVGFGNGSVAIIRGDLIHDRGARQRIVFESEEPITGLEVQ
SGPVTTLYISTTNRILALVISGRGQGQPARVLEDTGCGLGCMTLDRESGDVLVAREDAIY
TYGPHGRGQSYAFESPKSSINIFKDYVTLVCPPRGGTPGSTGLPTLGVGRDELFSSATFT
LLDTDLKFIAHSESLVSSVRQIFKEWGNLYLLTTDGKIYRYREKSLQQRLEILYQRNLYI
LAINLAQKIGVDAYQQNTIYRRYGDYLYQKGDYDTAMQQYLRAIDNTEPSQVIRKYLDTQ
RIHNLIEYLEELHDHDRASVDHTTLLLNCYAKLKDTKKLDAFIKAPGELKFDLETAIAMC
RQGGYYEQAAYLATKYGENDMVVDILVEDSKKYAEALEYIWRLEPVLSKAYSNLMKYARV
LLSNCPSTTTELFIEYYGGDYKPRTQQVEPLPEPQAQNGNPLQSLAAFLPLPLLKTGLSS
TATEPVETQAPEVQEERAPEYQIPKPRTAFSAFVSHPQEFITFLEALINKEDFFFSNEDR
VDLYTTLFEMYLNSAGRQKDTAEKEKWQNKAKKLIEGKDIPISTSNVLLLSDLSEFQEGS
TLVREQAGLRSDIFRSFTAAKDTQGAIRALKKYGPEEPQLYVDALTYFTSSPKILEEAGD
ELDAVLKRISEDGLMSPLQVIQALSNNAVVTMGRVKKYLSDNIERERKEISSNRRLISSY
STETEAKMQELEQLGSKPVVFQARRYSDDDEEPFEEPPRERTNRVSVVNDKMQHDADIQA
QDVSHDSHIRVDFDLFLQSQNDQQTNLSASQQRREERWIPSMGHSGSSGNMTTEIGLAQQ
RLFDDDQQAQSPPLQTITYEPEQVPDDNYAIAAPDNNPEAHELQNITTQGQSSRTDTHGV
DISDWSQTASYNIFDSSSHTSRNLLNGADFDCDSNITTRTEAMQNFEFRRWTTMQGTTSS
PHDTEPFSSIISPRIPRAKSDNATLNSAQLSSVSVDELSLPVTMEAPNIEMKGCKKKQAV
VANDDDDELSLPQFHEESPTKPEKRKPGRPPKRAKVDDTVSKGPITKTADISPEENQGPA
VPGAPGGITVHVAPPQSIIDDFMHDNQSEQPAAPALEQSLQTTATLTKEPKKKKLKRGKT
TSVTLTKTYESDIEDDVIWVEQRPATPIDEENKPSNPTRTSGTKVAEQTSAPKKRGRKRK
KMSEQQDQRTPAPLEVDEQDAQTTTSNEADNTPRLSDTHNESGVLVVLETKKTTDAQTSD
IMEPITKDQAPLDLHPPTSPAKPSEHAQPAQQAPETPRKRTDLKAPSVKGPGKHSPISST
SKVPYRVGLSKKAKIAPLLKIIKR
NT seq 4395 nt   +upstreamnt  +downstreamnt
atggctctgacatcttggaaagcattcaacttcttcgatgtgtccccagtgaagcttcct
gaagacagtgcgtccttatttaactccgaaacctcctgcttatgttctggctcggctaat
ctcttcctcgggaccactgacggattcgtgcacaccatttcttcatccttcaaggtcgtc
cagtccttcaaagcctctgataatggctcgatcacccatataaagcagctggaagggacc
tcgctcctagtgacaatagcggaggatctattgaatgagccagtactgaaagtctgggcc
ctcgataaccccgagaaaaagacagggattccgcgctgtttgtcgactacacccgtacaa
aatgcgcggaggctgtttcctgtatccgcatttgcggcgcttggagatttgtcccaagtt
gcggttggtttcggcaacggctccgtcgcgattattcgaggcgacttaatacatgaccgc
ggggcgcgacaacgtatcgtattcgaatcggaggagcccatcaccgggcttgaggtgcaa
agtgggccggtcactactctctatatctccacgacgaaccggatcctggcgctcgtgatt
tccggtcgaggacagggacaaccggcacgagtattggaagacacaggatgcggccttggc
tgtatgactctggacagagaaagcggcgacgtccttgtggctcgagaggacgcaatatat
acgtacggtccccatggacgaggccaaagttatgccttcgaaagccctaagagctccatc
aacattttcaaagactatgttactttggtttgcccccctagaggtggaacgccagggtca
acaggactgccgactcttggtgttggtagagatgaactattcagctctgccacttttact
ctcttagatactgacctcaagttcatcgctcattcggagtctctcgtgtcgtcggtaaga
cagatcttcaaagaatggggcaatctctatctccttacaacagatggaaagatttatcgg
taccgagagaagagccttcaacaaagactcgagatcctttaccagcgcaacctctatatc
ctggccatcaacctggcgcagaagatcggtgtcgacgcgtatcagcaaaacaccatatac
cgcaggtacggagattatctttatcagaaaggagattacgacaccgcaatgcaacaatac
ttgagagccattgacaacacggagccgtctcaagttattaggaagtacctcgacacgcaa
cgaatccataatcttatagaatacctggaagaattgcacgatcacgaccgagcctcagtg
gaccacaccaccttactcctcaattgctacgcgaaattgaaagacacaaaaaaattagat
gctttcattaaggcgcccggtgaacttaaatttgatcttgagacagccattgccatgtgc
cggcaaggcgggtactatgaacaagctgcctatctagctacaaaatacggcgagaatgac
atggtcgtggatatactggttgaggattccaaaaagtacgccgaagcgctggagtacatc
tggaggttggagcctgtattgtccaaggcttacagcaacctgatgaagtatgcccgtgtg
ctgctgtcgaattgcccttcaacgactacagagctttttatagaatactatggaggagat
tacaaaccaaggacgcaacaagtcgaaccgctacctgagcctcaagcacaaaacggcaat
cctttacagagcttagctgcatttcttccattgcctttgctcaagactggtttaagttca
acggcgacggaaccagttgagacccaagcccctgaggttcaggaagaacgcgcgccagag
taccagatccccaaaccacgcactgcattctcagcctttgttagccacccacaagagttc
attacattcctagaggcacttatcaacaaagaggactttttcttcagtaacgaggataga
gttgatctctacacaacgctttttgagatgtatctcaattcagcgggacggcagaaggat
acggcagagaaggaaaagtggcaaaataaagctaaaaaactgattgaagggaaagatatt
cctatctcaacctctaatgtcctactgctctccgatttatcggagtttcaggagggctcc
acacttgtccgggaacaagctggccttcgatcggatatatttcgatctttcactgctgcc
aaagatacacagggagctattagggcgttgaaaaaatacggccctgaagagcctcagcta
tacgtggatgcgttgacatactttacatcgagcccgaagatcctggaagaggctggtgac
gagctggatgctgtcctgaagagaatctctgaggatggcctgatgtcaccactgcaagtg
atccaagcactcagcaacaacgcggtcgtaactatgggaagggtcaagaagtatttaagc
gacaatatcgagcgggaacgcaaggaaatatcttcaaaccgtcgcctgatatcaagctac
agcactgaaactgaggcgaaaatgcaggagctagaacagctgggttccaaacccgttgtg
ttccaggcacgtcgatattccgatgatgacgaggaacccttcgaggagcctcctcgcgag
cgaacgaaccgtgtttcagtggtaaatgataaaatgcagcatgacgcagatatccaggct
caagatgtcagccacgattctcacattagggtagacttcgatttatttcttcaatcacaa
aatgatcagcaaacaaatctgtccgcttcccagcagcgcagggaagaacgatggatacca
tctatggggcacagtggatcatccggaaacatgacgacggagattggccttgcacaacag
cgactgtttgacgatgaccagcaagcgcagtctcctcccctgcagaccataacctacgaa
cccgaacaagtaccagacgataattatgcaattgccgcacccgacaacaaccctgaggct
catgaacttcaaaatataacaacacaaggccaatcctctcgcaccgacacccacggggtc
gacataagcgactggtcgcagacagcttcatacaatatctttgactcgtcatcccacact
tctcgcaacctactcaacggagcagactttgattgtgactcaaacatcacaactcgaacg
gaagctatgcagaatttcgaatttcgccgatggaccacaatgcagggaacgacttcgtcg
ccgcacgatacggaaccgttctcatcaatcatttctcctcggattccaagagcaaaaagt
gacaatgccactctcaatagtgctcagctgtcgtctgttagtgttgatgaactttcacta
cctgtcacgatggaagcgcccaatattgagatgaagggctgtaagaagaagcaggctgta
gttgcgaacgacgatgatgatgagctttctctcccacaatttcatgaagaatcacctact
aaacccgaaaagcgcaagccaggccgacccccgaagagagcgaaagtggacgacacggtt
agcaagggccccatcactaagactgcagacatttcacctgaagagaaccaagggccagca
gttccaggtgctccaggcggcattactgtgcatgttgctccgccgcagagcattattgat
gatttcatgcatgataaccagagcgaacagccagccgcgccggcgctagaacaaagttta
caaacaaccgccacgttaaccaaagagcccaagaaaaagaagctgaaacgcggcaaaaca
acttcggtgactctgacgaagacctacgagtcagatatagaagatgacgtgatttgggtc
gaacagagacctgctacacctattgacgaagagaacaaaccctccaaccctacaagaaca
agcggcactaaggttgcagaacaaacatcagcacctaaaaagcgcggtcggaaaaggaag
aagatgtccgagcagcaggatcaaagaacacccgcaccactagaggtagacgagcaggat
gcgcaaacaacaacctctaatgaagcggacaatacgccacgattgagtgacactcacaac
gagtccggcgtattagttgtcctcgaaaccaaaaaaacaaccgatgcgcagacctcggat
atcatggaacctataaccaaagaccaagcaccccttgacctccatccaccaacctcaccc
gccaaaccctctgagcacgcacaaccagcccaacaagcccccgaaacaccccggaagcgc
acagacttgaaggctccatccgtaaaggggcccggtaaacatagtcccatatcatcaacc
agcaaagtcccataccgtgtcggactcagtaagaaggctaaaattgcacccttactgaaa
atcattaagcggtga

DBGET integrated database retrieval system