KEGG   Aspergillus nidulans: AN2887.2
Entry
AN2887.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K08330  autophagy-related protein 11
Organism
ani  Aspergillus nidulans
Pathway
ani04136  Autophagy - other
ani04138  Autophagy - yeast
ani04139  Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN2887.2
   04136 Autophagy - other
    AN2887.2
   04139 Mitophagy - yeast
    AN2887.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN2887.2
   03029 Mitochondrial biogenesis [BR:ani03029]
    AN2887.2
Membrane trafficking [BR:ani04131]
 Autophagy
  Cytoplasm to vacuolar targeting (CVT) pathway
   Scaffold protein
    AN2887.2
  Mitophagy
   Scaffold proteins
    AN2887.2
Mitochondrial biogenesis [BR:ani03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AN2887.2
SSDB
Motif
Pfam: ATG11 ATG17_like Crescentin DUF2142
Other DBs
NCBI-GeneID: 2874085
NCBI-ProteinID: XP_660491
UniProt: Q5B993
Position
VI
AA seq 1371 aa
MSRFRPLPQKYARPLRRNEIFLYDRRYVSEQDNADLPKLPSPQPLVLDKPPDTLSDRNDL
QAWRNLYAARKTWAAELTERCEMADTSIRELNERTGIVNRAASVALENLKTHVAALENRF
QEAQAWAKELSREQKSALEEWKRALANLENIPARKEFSFLGRPSTPKKDADRATGTLLDY
VDAVEVQKAGPEASAASSRFAQQIQDIERAVGEITAGTQRLLDDVPNSRTDTADGLLQEI
EPLSRKIQSDYEHVLGLSNNSKTLANISRLALNHTQDILPSMLEIAMEIRESLAAAVRQY
DAATKSALGRTKLISAIQSRLADVQAHIANLTFQSDAFDLLYSVFHMPLVYGSVLIESVR
RHEFNEKMKSDSLTLAEELSIFQDEEQRRRKKWVKNMEDFLSVTDTTTPGIEVNLRGHEF
DWPIVTRKDIETYIEDLRSNPGTANAAQELAQAFKELDAPTRVQRRRAKAFKQGSIFDLS
RSSLLLHSDEIVRSLRDEKLKLEEKLRGSESRIRKLEDLLHRHSHLGRPSSGNFSIDFPA
SPASPHPDPMSRRSSVSSRRLSSNQTSEEKNLVNRIVHLEADLAIERETVQRLQREADAE
RQSNTNKMQEAQSTKNDLIGNLEARQREFSDERRYLEGEVKRFKIRVEELEEELDRLTDS
RDHEKQDADERMHQLELELQDAHARADAEMRKANNLLEQMQSHREAADRSKLRMDELEKQ
ATERTQKDQEVRHALQAAFMNLSPGGSVPDEIVDIIKAIDVLSEGLTIHAKTAEDNAMKA
AAENKTLIEQLEKMESNYENAKSASEQYQTQLTQAREEVEQEQSKVKAIESELNDERASL
LELESKLAAGETGAGALREHVAEEEQKLNNMSQQLAETEARARRSEEEALQWRKRAEALS
ESDKQVAARIDIRTARLEELSRQLFGQVEKLERMLEQLGFTVIRQDGEIVVQRSSKVNAL
SATADTLSQSGVVSVKPDPSLLNWMQGEHPEEETERFNAFLESLHQFSVDIFGDAVVKRV
KDIEVLARKWQKEARGYRDKYHRMQSEAHDKIAYRSFKEGDLALFLPTRNQAIRSWAAFN
VGAPHYFLREQDVHKLQARDWLLARITKIEERVVDLSKSMNGGNPDRRSIGEASDGASID
DENPFELSDGLRWYLLDATEEKPGAPATPGLGKSTVAPAHVDAKGSIRLKRTPAGGNVTK
TLTRSLDSRRNSSASASIKRGTPPSRANDSTTDLVRPAQAESESIAAATDSKSQSQSQSQ
ERERRQEAQGTAVIFDEGLERQRSQTLERSSVLGGSTRHPRLDRDYDRDRDANARSISLC
PHNTNAVSYTVSPSASTSTTFSSPSRRQSTRYRPWEKLWSVDLDYRLESGN
NT seq 4116 nt   +upstreamnt  +downstreamnt
atgtcaagattcagacccttgccacagaagtatgcccgaccgctccgcagaaacgagata
ttcttatacgatcgacgatacgttagcgaacaagacaacgcagatctgcccaagctccct
tctccccaacctctcgtgctcgacaagcctccggatacgctttcggatcggaacgaccta
caagcatggcggaacctatacgcggctcggaagacatgggccgccgagctaacggagcgg
tgcgagatggcggatacgagtatccgcgagctgaatgagcgcaccggaatcgtcaatcgg
gctgcaagcgtcgctctcgagaaccttaagacgcacgtggctgccttggagaaccgattt
caagaagcccaggcttgggcgaaagaactgtccagggaacagaaatcggcgcttgaagaa
tggaaacgtgcccttgctaacctcgaaaacattcctgcgcgcaaggagttctcttttctt
ggccgcccgtcgacacccaagaaggatgctgacagggcgacggggacattactcgactat
gtggacgcagtggaggtacagaaggctgggccggaagcttctgcagcgtcctcgcgcttt
gcccagcagattcaggacattgaaagagcagtcggggagatcactgccggcacccagaga
ctgctcgatgatgttcccaattcgaggacggacaccgctgacggtctattacaagagatt
gaacctttatccaggaagatccaatccgattacgagcatgtcctcgggttatccaacaac
tccaaaacactggccaacatatctagacttgctctcaaccatacccaggatatattgcca
tcgatgctggaaattgccatggaaatcagagaaagcctggcggcagctgttaggcagtat
gacgctgcaacaaaatccgcgcttggccgcacgaaacttatatccgctatacaatcgcgc
ctagctgacgtacaagcacatatcgccaaccttactttccagagcgacgccttcgatctg
ctgtactccgtcttccacatgcccttggtatatggatctgttttgattgagtccgtaagg
cggcacgagtttaatgagaagatgaagagtgattcgttgaccctggcagaggaactgtca
atctttcaagacgaggaacagcgtcgaagaaagaagtgggtaaagaatatggaagatttc
ctttctgttacagacaccaccactccgggaatcgaggtcaacctacgaggacatgagttt
gattggccaatcgtgaccagaaaggacattgaaacatacattgaagacctgagatcgaat
cctggtacagccaacgctgcgcaggagttggcccaagcttttaaagagctcgatgctcct
acgcgcgtgcaacggcgcagagcaaaagcatttaaacaaggcagtatttttgatctaagc
cgcagctcgctcttactccatagcgacgaaatagttcgaagcttgagagatgagaagctc
aagctagaggagaaattacgaggctcagaaagcaggattcgcaagttagaggaccttctt
catcggcacagccatttaggccgaccttcaagtggcaatttctctattgacttccctgca
tctccagcatctccgcatccggatcccatgtcgagaagatcttcggtatcatcacggcga
ttgtcttcgaatcagacatcggaggaaaagaatctggtgaatcggatcgttcatctcgaa
gctgatctcgctattgaacgggaaactgtgcaacggctgcagagagaagcagatgccgaa
cggcaatccaataccaacaagatgcaagaagctcaatctacgaagaacgaccttattggg
aacctcgaagcccgacaacgagaatttagtgatgagcggcggtacttagaaggcgaggtt
aagcgattcaagattcgcgttgaggagctcgaagaggagttggatcggcttactgacagc
cgcgatcacgagaagcaggatgcagatgagcgtatgcaccagctggagctggaattacag
gacgcacatgcgcgtgcagatgcagaaatgcgaaaagcgaacaacttactagaacagatg
cagtctcatagggaggcggcagatcgctccaaacttcgaatggatgaacttgagaaacaa
gccacagaacgaacccagaaggaccaggaagtgcgccatgccctgcaggctgctttcatg
aacctttctcctggcgggtccgtacccgacgaaatcgtggacatcatcaaggcaatcgat
gtcctttctgaaggcttgaccatacacgctaaaactgccgaagataacgctatgaaagcc
gcggcagagaacaaaacccttatagagcagcttgagaagatggagtcgaattatgagaat
gcaaagagtgcttcagagcagtatcagactcaactgactcaagctcgcgaagaggttgaa
caagaacagtcgaaggtaaaagctattgaatctgagctgaacgatgaacgagctagttta
ctagagctggagtctaaactcgctgcaggcgagacaggcgcaggcgccctacgagaacat
gttgcagaggaagaacagaagctaaataacatgtcccagcaactcgccgaaaccgaggct
cgggctcgacgatcagaagaagaagccttgcagtggagaaagcgggctgaggctttgtct
gagtctgataaacaggttgcagccaggattgatattcgcacggcaagacttgaggaactc
tcgagacagctgtttggacaagtggaaaagctggagcgcatgttggagcagctaggcttt
actgtcattcgccaagatggagagatagtagttcaacgatcctccaaagtcaatgccctc
tctgctactgcagacactttgagtcaatctggtgtggtttctgtgaagccggatcccagc
cttcttaattggatgcaaggcgaacaccctgaagaagagacggagagattcaacgccttc
ctggagtcattgcaccagtttagcgtggacatcttcggcgacgcggtagtgaagcgcgta
aaagacatcgaggttctcgctcgaaaatggcagaaggaagcccgaggctaccgagacaaa
taccaccgtatgcaaagcgaagcgcacgacaagatcgcttacaggtcattcaaagaaggc
gatctcgcgctcttcctgccaacccggaaccaagccatccgctcatgggccgctttcaat
gtcggtgcaccgcactacttccttcgcgaacaggacgtccacaaactccaagccagagac
tggctccttgcacgaatcaccaagatcgaagagagagttgtcgatctgtctaagtccatg
aacggtggcaacccagaccgtcgctcgatcggcgaagcaagcgatggcgcctcaatcgat
gatgaaaaccccttcgaactttctgatggactccgatggtacctcctagacgccacggag
gagaaacctggcgcgccagcaaccccgggtttagggaagagcaccgttgcccctgcgcac
gtcgacgccaaaggcagtatccgtctcaaacgtacacctgccggaggcaatgtcacaaag
acactcaccaggagcctcgacagccgtcggaacagctccgcctccgcctctatcaaaaga
ggaacaccgccatcccgagcaaacgactcaacaacagacctcgtccgtccagcacaagct
gaaagcgaaagcatcgctgctgctacagactccaagtcccagtcccagtcccaatcacaa
gagcgggaacgaaggcaggaggcacaagggacagctgtcatcttcgatgagggcttggag
cgtcagcggtctcaaacacttgagcgaagcagtgtactcggcggatccacacgtcatcca
cgtctagatcgtgactatgatcgtgaccgtgatgccaatgcgaggtccatctcattgtgt
ccgcataacaccaacgcggtatcctatacggtgtcaccttcggcgtcgacatcgactacc
ttctcgagcccgagccgtcgtcagtcgacccggtatcgaccctgggagaagctgtggtcc
gttgatctggattatcggctggaaagcgggaattga

DBGET integrated database retrieval system