KEGG   Aspergillus nidulans: AN2903.2
Entry
AN2903.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K01381  saccharopepsin [EC:3.4.23.25]
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN2903.2
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ani01002]
    AN2903.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.25  saccharopepsin
     AN2903.2
Peptidases and inhibitors [BR:ani01002]
 Aspartic peptidases
  Family A1: pepsin family
   AN2903.2
SSDB
Motif
Pfam: Asp TAXi_N Asp_protease_2 TAXi_C
Other DBs
NCBI-GeneID: 2873983
NCBI-ProteinID: XP_660507
UniProt: Q5B977 A0A1U8QY99
Position
VI
AA seq 394 aa
MKASLLTASVLLGYASAEVHKLKLNKVPLTEQFITRNIADHANALGQKYMGQFQQHVLED
EPVNAMRGHDVLVDNFMNAQYFSEIQLGTPPQTFKVVLDTGSSNLWVPSSECGSIACYLH
QKFDSSASSTYKKNGSEFAIKYGSGSLSGFVSRDNLQIGDLKVKGQDFAEATSEPGLAFA
FGRFDGILGLGFDTISVNRIVPPFYNMIHQGLLDEPVFAFYLGDANKDGDSSVATFGGID
KDHYEGELIKIPLRRKAYWEVDLDAIALGDEVAELENTGVILDTGTSLIALPSNLAEMIN
TEIGATKGFTGQYTIDCAKRDSLPDLTFTLTGHNFTIGPYDYTLEVQGSCISAFMGMDFP
EPVGPLAILGDAFLRKWYSVYDLGNGAVGLAKAK
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgaaggcttccttgctcacagcttctgtgctgctgggctatgcctccgccgaggttcac
aagctcaagctcaacaaggttccccttacagagcagttcatcacgcgcaacattgccgac
catgcaaatgccctaggccagaagtacatgggccagttccagcagcatgtacttgaggac
gagccagtcaacgccatgcgcggtcacgatgtgctggtcgacaatttcatgaacgcccag
tacttctccgaaatccagctcggtaccccccctcagaccttcaaagttgtccttgacaca
ggtagctccaacctatgggtgccatcgtcagagtgtggctctatcgcttgttacctgcac
cagaagttcgactcttctgcctcgtccacatacaagaagaatggtagtgaatttgccatc
aagtacggatccggcagcttgagcggattcgtgtccagggacaacctgcagattggcgac
ttgaaggttaagggacaagacttcgccgaggctaccagtgagcccgggttggcttttgca
tttggccgttttgacggtatccttggcctcggatttgacaccatctccgtcaacaggatc
gtccctccgttttataacatgatccaccagggtctgctcgatgagccggtctttgctttc
taccttggtgatgccaacaaggatggcgacagctccgttgccacctttggtggtattgac
aaggatcattacgagggcgagctgatcaagattccccttcgccgcaaggcctactgggag
gttgaccttgacgccattgctcttggcgatgaggttgctgagctcgagaacactggtgtc
atcctcgacaccggtacctctctaattgctcttccttccaacctcgctgagatgattaac
accgagatcggtgccacaaagggtttcactggccagtataccattgactgcgccaagcgc
gactctcttcctgacctcacttttactctgaccggccacaacttcaccattggtccttat
gactacaccctcgaggtccagggttcctgcatcagtgccttcatgggcatggacttcccc
gagccagttggccctcttgctatcctcggtgacgcctttctacgcaagtggtacagcgta
tatgaccttggcaacggtgccgttggtctcgccaaggccaagtaa

DBGET integrated database retrieval system