KEGG   Aspergillus nidulans: AN3098.2
Entry
AN3098.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K06027  vesicle-fusing ATPase [EC:3.6.4.6]
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN3098.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN3098.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.6  vesicle-fusing ATPase
     AN3098.2
Membrane trafficking [BR:ani04131]
 SNARE
  SNARE associated proteins
   Others
    AN3098.2
SSDB
Motif
Pfam: AAA CDC48_2 AAA_16 AAA_22 AAA_lid_3 AAA_5 AAA_18 RuvB_N Mg_chelatase TIP49 NACHT TsaE RNA_helicase AAA_24 ATPase CDC48_N AAA_33 AAA_7 IstB_IS21 AAA_25 AAA_14 Sigma54_activat bpMoxR NB-ARC PhoH Zeta_toxin
Other DBs
NCBI-GeneID: 2873847
NCBI-ProteinID: XP_660702
UniProt: Q5B8N2 A0A1U8QZK5
Position
VI
AA seq 775 aa
MFNRNNYSNPFGSNPPQRDGYSRPPQGYPPQHGAPDSGGYGTPPPRRPAPGARPPPQAPM
GGRPSEGGVWALTPKESPNKECQFGNLVALSAQDFPRAQFGYEDILIIVNGLYVFSARIL
DEFPPGYIGLSSIQRPWARAGFRDSLDVRIYDPFRQGGEAYLGSADMEVKFAGKLRPDTL
YDQDELLNSVIKNFESQIFAPGQPVLMDHHGVPLQLTVKTILRVSLTSEKDTSKVPETEP
TARGILTKHTLINFFKDPQSEIQIKPAKNRPAANAIIQPDFNTEKMGIGGLDSEFHTIFR
RAFASRIFPPDIVQKLGIQHVKGILLFGPPGTGKTLLARQIGKMLNAREPKIINGPERGS
GAGGGTGVGDSVVNQLLSKMDGVDQLNNILLIGMTNRKDMIDDALLRPGRLEVHVEISLP
DEAGRAQILGIHTQNMRQSDLMDPSVNLSELATLTKNYSGAEIAGLVKAATSFAFNRHID
SGKTVRVKDDAAEMKVNHSDFIHALDEIQPAFGVSEDEIKRCIEHGIINYSDKIDNVLQE
GEALARGLGRPEQTTLWSVLLNGPPGSGKTALAAQIALDSGAPFIKMVCPEDVAGYNEAA
KIQHILRVFNDAYKSQTSVVVVDDIETLIDYVSVGPRFSNSVLQTLKVLFKKRPPKNRRL
LILATTSERALMKELNIYNSFNSDIDIPNVTSHEELRHVMEKSEVFASEQVAEALERIDP
LKGETPYSMTFGVGIKKVFDGIELAKKTPDQLVNQFVRFINSAVQEGGLTTRRAV
NT seq 2328 nt   +upstreamnt  +downstreamnt
atgttcaatcgcaataattactcgaaccctttcgggtccaatcctccccagagggatggc
tactcacgacctccgcaaggctacccacctcagcacggagctcctgactcagggggctac
ggaacgccaccgccgcgacgacctgcgccgggtgctcgtccaccaccgcaagcaccaatg
gggggcagaccaagtgaaggaggggtctgggctttgacgcccaaggaaagtccgaataaa
gaatgtcaattcggaaacctcgtcgcgctctcggcccaagacttcccacgcgcccaattc
ggttatgaagatatattgatcattgtcaatggcctctatgtgttctccgcacgaattctg
gatgagttccctcccggttacattgggttgtccagtatacaacgaccatgggccagggct
ggattccgagactccctcgacgtacgaatttacgaccctttccgtcagggaggggaggcg
tacctcggctctgcggatatggaagtcaagtttgctggaaagctaagacccgatactcta
tatgatcaggatgagcttctcaactctgttatcaagaacttcgaaagccaaatatttgcg
ccggggcagccggtactgatggatcatcatggcgtaccgcttcagctaacggtcaagacg
atccttcgtgtcagcctgacttcagaaaaggataccagtaaagtgccggagacggaacct
acagccaggggcatccttacgaagcatacgttgatcaatttcttcaaagatcctcagagt
gagatccagataaagccggcaaaaaaccggcctgcagcaaatgccatcattcaacccgac
ttcaacactgagaagatgggaattggtggtcttgactcggaatttcacacgatcttccgc
cgcgccttcgcgtcgcgtatcttcccacctgatattgtgcagaagcttggtatccagcac
gtgaagggtattttgctcttcgggccgccaggaactggcaaaacgctgctagcgcgacag
atcgggaagatgctgaatgctcgagagccaaagattatcaacggcccggagcgtggcagc
ggagcaggaggcggcaccggtgtcggtgacagcgttgtcaaccaactgctatctaagatg
gatggtgtcgaccagctcaacaatattctacttatcggtatgaccaataggaaggatatg
attgatgatgctttgttgcgacctggtcgtctggaagtgcacgtcgaaatctcactgcct
gacgaagctggtcgagctcagattctcggcatccacacccagaacatgagacagagtgat
ctaatggatccaagcgtcaatttgtcggaactagcgacgttgacgaagaactattcgggt
gctgagattgctggcctcgtgaaggctgctacgtcgttcgccttcaaccgccacattgac
tccggtaagacagttagggttaaggacgatgccgcggaaatgaaggtcaaccactccgat
tttattcatgctcttgatgaaatccagccagctttcggtgtgtctgaagatgaaatcaag
agatgcattgagcatggtatcataaattattcggacaagatcgacaatgttcttcaagaa
ggagaagcgcttgcaagagggcttggccgccccgagcagaccactctatggtccgttttg
ctcaatgggccgcctgggagtggtaagaccgctctcgcagctcaaatcgctcttgattca
ggtgcaccttttatcaaaatggtctgccccgaagatgttgccgggtataatgaagcagct
aagattcaacacatactcagagtcttcaatgatgcatacaagagtcaaaccagcgtcgtc
gtcgttgacgatattgagacacttatcgattatgtctccgttggtccccgattcagcaac
agcgtcctacagacattgaaggtcttgttcaagaaacgccccccaaagaaccgaagactt
cttatcttggctaccacaagtgagcgagcactcatgaaagagctgaacatttataactcg
ttcaactccgatatcgatattccaaatgtcaccagccatgaagaactgagacatgtcatg
gaaaaatctgaggtgtttgcgagcgagcaggtagcggaggctttggaacgcatcgatcct
ctcaagggagagacaccatacagcatgacttttggtgttgggatcaagaaggtcttcgat
gggatcgagcttgcgaagaagacgccggaccagctggtgaatcagttcgtgcgcttcatc
aacagtgcagtacaagaaggaggattgactactagaagggcagtttag

DBGET integrated database retrieval system