KEGG   Aspergillus nidulans: AN3156.2
Entry
AN3156.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K03237  translation initiation factor 2 subunit 1
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
ani04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ani00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AN3156.2
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN3156.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ani03012]
    AN3156.2
Translation factors [BR:ani03012]
 Eukaryotic type
  Initiation factors
   eIF-2
    AN3156.2
SSDB
Motif
Pfam: EIF_2_alpha S1
Other DBs
NCBI-GeneID: 2873856
NCBI-ProteinID: XP_660760
UniProt: Q5B8H4 A0A1U8QIH9
Position
VI
AA seq 308 aa
MSLTNCRFYEEKYPEVDSYVMVNVKQIAEMGAYVKLLEYDNIDGMILLSELSRRRIRSIQ
KLIRIGRNEVVIVLRVDKEKGYIDLSKRRVSPEDVIKCEERYNKSKAVHSILRHVAEATQ
TPLETLYQQIAWPLNRKYGHSHDAFKISITNPDVWADVEFPNEAVKKELTQYIGKRLTPH
PTKVRADIEVTCFGYDGIDAVKNALRTAEAENTPENQIKVKLVAPPLYVLTSQCLDKTHG
IKMLEEAIERIETTIKASGGGCTVKMAPKAVTEHDDAALQELMEKRERENMEVSGDESQS
ESDEGVPE
NT seq 927 nt   +upstreamnt  +downstreamnt
atgtcgctcacaaattgtcggttctacgaggagaagtacccggaggttgacagttatgtt
atggtcaacgttaagcagattgccgaaatgggtgcctacgtgaagcttctcgaatatgac
aacattgacggcatgattctgctctctgagctttcgcggagacgtattcgtagtatccag
aagctcatccgcattggccgcaacgaggtcgttattgtgctccgtgtggacaaggagaag
ggttacattgatctgtcgaagcgacgagtttctccagaagatgttatcaaatgcgaagag
aggtacaacaagagcaaggctgtccactcgattctgcgacatgttgcagaggcaactcag
acccctcttgagacgctataccagcagatcgcctggccgttgaaccgaaaatacggccac
tcgcacgatgctttcaagatctcaatcacgaaccccgatgtttgggccgatgtcgaattc
cccaatgaagccgtgaaaaaggagctgactcagtacattggcaagcgacttacaccccac
ccgacgaaagtgcgcgcggatattgaagtcacctgctttggttatgatggtatcgatgcg
gtcaagaacgctctgcggaccgctgaggcagagaacactcctgagaaccaaataaaggtc
aaactggttgctcctccgctctatgtcttgactagccaatgtctggacaagacacacggt
atcaagatgcttgaagaagccattgaacggattgagaccacgatcaaagcgtctggcggt
ggctgcactgttaagatggctcccaaggctgttacggagcacgatgacgctgctcttcag
gagctcatggagaagcgcgagcgtgagaacatggaggtcagcggagacgagagccagtct
gagagcgacgagggtgtccccgaataa

DBGET integrated database retrieval system