KEGG   Aspergillus nidulans: AN3470.2
Entry
AN3470.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K08342  cysteine protease ATG4 [EC:3.4.22.-]
Organism
ani  Aspergillus nidulans
Pathway
ani04136  Autophagy - other
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN3470.2
   04136 Autophagy - other
    AN3470.2
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ani01002]
    AN3470.2
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN3470.2
   03029 Mitochondrial biogenesis [BR:ani03029]
    AN3470.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     AN3470.2
Peptidases and inhibitors [BR:ani01002]
 Cysteine peptidases
  Family C54: Aut2 peptidase family
   AN3470.2
Membrane trafficking [BR:ani04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    AN3470.2
Mitochondrial biogenesis [BR:ani03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AN3470.2
SSDB
Motif
Pfam: Peptidase_C54
Other DBs
NCBI-GeneID: 2874196
NCBI-ProteinID: XP_661074
UniProt: Q5B7L0
Position
VI
AA seq 379 aa
MNATDIERCRKRIIQYIWDPEPKNDEEPGNPDHGQQQNTNTSAPGWPEAFLLDFESKIWM
TYRSNFPPIPKDAGQEGSLSLTLGVRLRSQLIDAQGFTSDTGWGCMIRSGQSLLANSMAI
LLLGRDWRRGERLEEEGKLLSLFADSPHAPFSIHSFVKHGADFCGKHPGEWFGPTATARC
IQGLAARYDQSNLQVYIADDNSDVHQDKFMSVSRDEKGTVRPTLILLGLRLGIDRITAVY
WNGLKAVLQLPQSVGIAGGRPSASHYFVAVQGSHFFYLDPHNTRPALRYSESGTYTEDEV
NTYHTRRLRRLNIQDMDPSMLIGFLIRDEDDWEDWKARIMSLEGKPIITILSESDAASWK
GRREALDEVEAFDDLDVAL
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgaacgcaacggatatagaacgatgcaggaaacgcataatacagtatatatgggatccc
gagcctaagaatgacgaggagcctggaaaccccgaccatgggcagcaacagaacacgaac
acgagtgcacctggctggcctgaagcgtttctgctggacttcgagtcaaagatatggatg
acatataggtcaaatttcccgccgattcccaaggacgctggacaagagggaagcttatca
ctgaccttgggcgtgcggctgagaagtcaactcatcgatgcccagggcttcacaagtgac
accggatgggggtgcatgataagatcaggccaaagcttactcgctaactccatggccatc
ctgttactgggccgtgactggcgaaggggcgaaagactagaagaagaagggaagctactc
tcgctattcgccgactcccctcatgccccattctcgatacacagttttgtcaagcacgga
gcagatttctgcggaaagcatccaggggaatggtttgggccaactgctacagctagatgc
atacaaggccttgcagcgagatacgaccagtcgaatctccaagtttatattgcagatgac
aactcggacgttcatcaggacaaatttatgagtgtgtccagggatgaaaaaggcactgtt
cgcccgacgctcatactgctgggtctcagacttggaatcgaccgtatcactgcagtatac
tggaatggactaaaagccgtgctacagctgccacaatccgtggggatcgcgggaggacgt
ccgtcagcttcccattattttgtagctgtccagggttcgcatttcttctaccttgaccca
cacaacacccgccctgctctaagatacagcgaatcagggacgtacacggaagatgaagtc
aatacctaccacactcgtcgactgagaagactcaacatccaagacatggacccaagcatg
ctcataggattcctaatcagagatgaggacgattgggaagactggaaagctcggattatg
tccctggaaggaaaacccataataacaatcctaagcgaaagcgacgccgcctcctggaaa
gggcgaagggaagcactagacgaagttgaggcatttgatgatcttgacgtcgcgttgtag

DBGET integrated database retrieval system