KEGG   Aspergillus nidulans: AN3734.2
Entry
AN3734.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K17907  autophagy-related protein 9
Organism
ani  Aspergillus nidulans
Pathway
ani04136  Autophagy - other
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN3734.2
   04136 Autophagy - other
    AN3734.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN3734.2
   03029 Mitochondrial biogenesis [BR:ani03029]
    AN3734.2
Membrane trafficking [BR:ani04131]
 Autophagy
  Autophagosome formation proteins
   ATG9 transmembrane protein
    AN3734.2
Mitochondrial biogenesis [BR:ani03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AN3734.2
SSDB
Motif
Pfam: ATG9
Other DBs
NCBI-GeneID: 2873148
NCBI-ProteinID: XP_661338
UniProt: Q5B6U6
Position
II
AA seq 820 aa
MMASNVLSRLLPQTGQSVYETIRQHDNDSDASDVEERAGLVYDDDVNLGNRFSDRELEEA
MADATREGSSSPSDTFLTPQIAQRGERSASSGPRMRKPNNPRFMRSVTPRPEFVEDDLDD
DHDDDVPASLLMEGQHDDEYLRTRLPPPPSHHFSDPQPSRSARSPRREHIRTFAFVVGFT
TFLTNCIDYRLVRTSKSLDQILISKCTSRMSASSTFLLWLLCLFWIGKIFQLILDIRRLK
NMHDFYHYLLGVSDAEIQTISWQEVVSRLMTLRDANPATAGAVSAFNRRLLGSQSKQRMD
AHDIANRLMRKENYLIALINKDILDLTLPIPFLRNRQLFSRILEWNINLCIMDYVFNEQG
QLSSRQYTPLAEWKFREFNELWHLFEKRINLSYPYATRYVDQFPKDKTVQVAGFVAFISG
ALASVLALASILDPELFLGFELTHDRTTLFYLGVFGSVWAFARGMVPEETLVFDPEYALL
EVIQFTHYFPSHWKGKLHSDDVRREFAVLYQMKIIIFMEEILSMIFTPFILWFSLPKCSE
RVIDFFREFTVHVDGMGYLCSFAVFDFKKGTNVIPQGHINQRDARQDPRVDYFSTKDGKM
LASYYGFLDNYGGNPRATNANKRAFHPPPTFPSLGSPPFVGASNIGNRQDPIQARVNTAS
AALGQQSMLGATRLGALGVGDTQSPAPSLLLDPQHQPSASGFRATNHIAPHHRQRLGRPP
PAPVSESIIDDNEPSIAAARRPAPRRKSGQLHTNSGSSEALGAGDSNVEDSWGMKSGGEV
NDEDAEENVDDVVGGAGVLGLIQQFQKVNKDNRPRAAVGL
NT seq 2463 nt   +upstreamnt  +downstreamnt
atgatggcctcgaacgtcctgtctcgcttgcttccccaaactggccagtcagtatacgag
acgatacgtcaacatgacaatgattccgatgcttcggacgtagaggaacgcgctggcttg
gtttatgatgatgatgtcaacctggggaatcgcttcagcgatcgtgaactcgaagaagct
atggctgatgctactcgggagggatcttcgagcccgagcgatacgttcttgacgcctcaa
atcgcacaaagaggggaacgctcagctagttccgggcctcgcatgcgcaaacccaacaac
cccaggttcatgcgttcagtaacaccgcggcccgagtttgtcgaggatgaccttgacgat
gaccacgatgacgatgtccccgcgtctctcctgatggaaggccaacatgacgatgagtat
ctgaggacgcgacttcctcctccgccttcgcatcacttctccgacccgcagccttctcgc
tctgctcgttctcctcgtcgcgaacacattcgaacgttcgcattcgtcgtggggtttaca
acgtttcttacaaactgcatcgactatcgtctcgttcgcaccagcaaatcactagaccaa
atactgatttcaaagtgtaccagccgcatgtccgcatcttctactttcttgctttggttg
ctctgccttttctggattggaaagatcttccaattaatattggatatcaggaggctcaag
aacatgcacgatttctaccactacttgctcggggtatccgacgcggagattcagacaatc
tcctggcaagaagtcgtcagtcgtcttatgacgctgagagacgccaaccccgctactgcg
ggcgctgtatcagcatttaatcggcggttattgggcagccaatccaaacaacgaatggat
gctcacgacattgcaaaccgtttgatgcgcaaagaaaactatctgatcgctcttatcaac
aaggatattctagatctaacgcttccaataccgtttctgcggaacagacaattattttcc
cgtatcctggaatggaatattaatctatgcattatggattatgtttttaatgaacaaggc
cagctttcctcacgccagtacacgccactcgccgaatggaagtttcgtgagttcaacgag
ctatggcatctttttgagaagcgaatcaacttgtcgtacccgtatgcgacccgctacgtg
gaccagtttccaaaagacaagaccgtccaagttgctggctttgtagcgtttatttcagga
gcgctggcctctgttttagctctagcgtctatcctagatccagagctgtttcttggattc
gagctaacgcacgatcggacgactctcttttatcttggtgtcttcggctctgtctgggcg
tttgctcggggaatggtgccagaggaaacgcttgtattcgatccggagtatgctctactc
gaagtcatccagttcactcactatttcccaagccactggaaagggaaattgcacagcgat
gacgttcggagagaatttgctgtattgtatcagatgaagatcatcatcttcatggaagag
atactgagcatgatttttacgcccttcatcctgtggttcagtctgcccaaatgcagcgaa
cgtgttatcgacttcttccgggagttcactgtgcacgtcgacggcatgggctatctttgc
tctttcgctgtgttcgatttcaaaaagggcacaaatgttatcccgcaagggcatatcaac
cagcgcgacgcgcggcaggaccctcgtgtggactatttctctacaaaagatggcaagatg
ctcgcttcatactacggtttcttggataattacggcggaaatcctcgtgctaccaatgca
aacaagcgcgcgttccatcctccgccaacgttcccgtccttgggatccccaccatttgtc
ggcgctagcaacatcgggaaccgacaggacccgatccaggctcgcgttaacacggcttct
gcagctctcggccagcaatcaatgttgggtgccactcgattgggagctctcggcgtcggt
gacactcaatctcctgccccctcgctcctcctcgacccgcaacatcagccatcagcatca
gggttccgagccacaaaccacattgcaccacatcatcgtcaacgtctgggccgtcctcca
ccagctcctgtgtccgaatctatcatcgatgataatgagccatctatcgcagccgcgcgt
cgccctgctcctaggcgaaaatcagggcaactacatacaaactctgggtcaagcgaagct
ctcggcgctggcgacagtaacgtcgaagactcgtgggggatgaaatcaggtggcgaagta
aatgacgaagacgcagaggaaaatgtagacgatgtagtagggggcgcaggggttcttgga
ctgattcagcagttccagaaggtaaataaggataaccgacctcgtgcagctgttggactc
taa

DBGET integrated database retrieval system