KEGG   Aspergillus nidulans: AN4238.2
Entry
AN4238.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K19800  serine/threonine protein kinase SCH9 [EC:2.7.11.1]
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN4238.2
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ani01001]
    AN4238.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AN4238.2
Protein kinases [BR:ani01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   AN4238.2
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C C2 Kinase-like ABC1 Haspin_kinase Adeno_E3_15_3 APH Choline_kinase
Other DBs
NCBI-GeneID: 2873661
NCBI-ProteinID: XP_661842
UniProt: G5EB50 A0A1U8QWW5
Position
II
AA seq 919 aa
MAAAQSGSENTELSKQPSPQNDGCQDDDNHDQIGSSTPSPSGIATPQPNPADRRLPSIMH
NYFQVGSSSAVMLRSLKTRFSLSDPSPSSADTMQSGSLANGTRDAQSSGHTSSSSGSFVI
MERDEARLESPTTPPDNEAETQEISQESRPPAALPTPPCSSACSLLQKESEEPEAGPDKG
MGSIFNTLKNYLSPSRSVSCSDSQARRHTSHPVSSISDDPVLASHFFNPSLSQTPESLCL
VEAPLLDHEKPHVSASSENAAKLTANVSNPSHLKNTPPHTPRAMSDEDLQSNGKAPASPP
RSSNPTHSPRDEPSDSADEITGKLNEVFPSSMDTSSSPSSGPPVASLKGKLHVKISEGKG
LQPGFDPYVVCVFEWNEVISKSVQDEEQESLKRQQKELEQSALDSGRPMAIPMNRQSSHN
NTLESTDHRGHAPITDPHWNHEAVFDVFGDQSEIDVSVYDRNDSEAFLGHVRLCVNLKED
NSRLDGWFPLKGRAAGDSRVSGEIHMEMRFEKTEKKQVGPNDFQILKLIGKGTFGQVYQV
KKKDTRRIYAMKVLSKKVIIQKKEVAHTVGERNILVRTAMAASPFIVGLKFSFQTPTDLY
LVTDYMSGGELFWHLQKEGRFQEPRAKFYIAELIMALQHLHDHDIVYRDLKPENILLDAN
GHIALCDFGLSKANLTQNDTTNTFCGTTEYLAPEVLLDEQGYTKMVDFWSLGVLVFEMCC
GWSPFYAEDTQQMYKNIAFGKVRFPRDALSTEGRNFVKGLLNRNPKHRLGAQNDAKELMA
HPFFHDIDWEALGRKEVIPPFKPKLKSDTDTSNFDPEFTNALENSNSLNDRAAALANGFM
AASTPLSPGMQANFQGFTFVNESSIDHHFKNEVGDRMDEDYEPMHRSHRSGNSIDHRMAG
VQKTGDAGEIFNVDDNFDM
NT seq 2760 nt   +upstreamnt  +downstreamnt
atggccgctgctcagagtggttcagaaaacacggagttgtcgaagcagccatctccccaa
aacgatgggtgtcaggacgacgataaccacgatcaaattggttcgagtaccccgagtccg
tcagggattgccaccccgcagcccaacccggctgacaggcgtctaccttccataatgcac
aattacttccaggttggtagttcttctgctgtcatgcttcgctctctcaaaacccggttt
tccctctccgatccttctccctcttccgcagacactatgcagtcgggttcgctagcaaat
gggacgcgcgatgctcaatcatcggggcacacttcctcgtcatcagggtcctttgtcatt
atggagcgtgacgaggctcgcctcgaatccccaaccacgccgccagacaatgaggcggaa
acccaagagatctcgcaagaatctcgtcctcctgcggcccttcccacccccccttgctcc
tcggcatgctcccttctgcagaaggagtctgaagagccagaagcgggccctgataaagga
atgggttctattttcaatacactgaaaaattatctatctccatctcgaagcgtgtcctgt
tctgattctcaggcacgtcgtcatacttctcatcccgtctccagcatttctgacgatccc
gtccttgcctctcatttcttcaacccttctctttcccaaactccggaatcactttgctta
gtcgaagctccccttctcgaccatgagaaaccgcatgtttctgcgtcttctgagaacgcc
gcgaagctaactgccaacgtgtcaaatccttcacacttaaagaatacccctcctcataca
cctcgggcaatgtccgatgaagatttgcaatccaatgggaaagctcccgcatcccctccc
cgatcatcgaaccccacccattcgccgcgcgacgaaccgtcagattccgccgacgaaatc
acaggaaaacttaacgaagtcttcccgtcgtcgatggatacttcttcctcaccgtcttcc
ggtcccccggtagcatctctcaaaggcaagctgcatgtcaagatttcggaggggaagggc
ctccaaccggggttcgacccatatgtggtctgtgttttcgagtggaacgaggtaatttcg
aagagcgttcaggacgaggagcaagaatccttgaaacgacaacagaaggaactagagcaa
tcggccctcgattctggacgaccaatggctattccgatgaaccgacagagtagccataac
aatactctcgagagcacagaccacagaggacatgctcctatcacagatccacactggaac
catgaagcggtctttgatgttttcggtgaccagtctgaaattgacgtctccgtgtatgac
cgcaatgactcggaagccttcctaggccatgtgcgactctgcgtgaatcttaaggaagat
aacagtcgcttggacgggtggtttcccttgaaaggtcgggcagcaggggactcccgagtt
tccggagagattcatatggaaatgaggtttgagaagacggagaagaagcaggtcggacca
aatgactttcaaatcctgaagctgatcggcaagggaacctttggccaagtctaccaggtt
aagaagaaggatacacggcgaatttatgcgatgaaggtgctctcgaagaaagttatcatt
cagaagaaggaggttgcgcacaccgttggagaaagaaatatcctggttcgaacagctatg
gctgcttctccgtttatcgtcgggctcaagttctctttccaaacacccacggatctctac
ctggtcacggattacatgtctggaggtgagctattctggcatctccagaaagagggacgg
ttccaggagccccgcgccaagttttacattgccgagctcatcatggctttgcaacatcta
cacgaccatgatatcgtataccgtgacctcaaaccggagaatattctgcttgatgccaat
ggtcacatcgcgctttgtgatttcggtctgtcaaaggcgaatcttacgcagaacgataca
acgaatacgttttgcggcacaacagaatatcttgccccggaggtactactcgatgaacaa
gggtatacgaaaatggttgatttttggtcactgggtgtcctcgtctttgagatgtgttgt
ggctggagtccgttctacgcggaggacacgcagcagatgtacaaaaacattgccttcggc
aaggtccggttccctcgtgatgctttaagcacggaaggacgcaactttgtgaaaggcctg
ctcaaccggaatcccaagcaccgcctgggagcccagaatgacgcgaaagaactcatggcg
cacccctttttccatgacattgactgggaggcactgggcagaaaagaggtcatcccaccg
ttcaaacccaagctcaagtccgacacagatacgtccaactttgacccagagtttaccaac
gctcttgaaaacagtaactcgctaaatgaccgagctgcagctcttgccaatgggtttatg
gccgcgtcgacgccgctctctccagggatgcaagctaatttccaagggtttacctttgtg
aatgagagctcgatcgatcaccatttcaagaacgaagtaggggatcgtatggatgaggat
tacgagccaatgcatcggtcccatcgatctgggaattctatagatcaccgcatggctggc
gttcagaagactggagatgcgggtgagattttcaatgttgacgacaattttgacatgtga

DBGET integrated database retrieval system