KEGG   Aspergillus nidulans: AN4477.2
Entry
AN4477.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K14209  solute carrier family 36 (proton-coupled amino acid transporter)
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN4477.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN4477.2
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ani02000]
    AN4477.2
Membrane trafficking [BR:ani04131]
 Autophagy
  Other autophagy associated proteins
   Others
    AN4477.2
Transporters [BR:ani02000]
 Solute carrier family (SLC)
  SLC36: Proton-coupled amino acid transporter
   AN4477.2
SSDB
Motif
Pfam: Aa_trans
Other DBs
NCBI-GeneID: 2872276
NCBI-ProteinID: XP_662081
UniProt: Q5B4Q3 A0A1U8QGQ7
Position
III
AA seq 739 aa
MASPGRYDNGEGSSTPKLGSSPIATSAHRSRSPAPDSVRHASIARLASPVPSISNSVSSR
QIPVPVSVGESQDLSRVDNLSSLPGPGQSMIASALQDSLGRSPPRFGTPPRRTESPVSNQ
NPQIRSNYGSFDQKPWREGSEYSAAPYEDPEIVKRHLVQPLESRDTQSSGYGTDNADDEF
SSLRLQGGDITRQVYRWAEDAEEGGSVRKPQRSRSFHLNRPTPEEDTMNINSIRVPGGFR
RDYLRRAVGSPRPGQSDAGDGASPAPRQLPTSSFLEFLTLYGHFAGEELEEDDEVLGPHE
YFSSDTWDEAEEREPGEDSALLHPEAPGKRRRKPRGGTGTNTRTGAALLLLKSFVGTGVL
FLPRAFLNGGMLFSSLVLLAVSLLSFYCFVLLVNARLKIEGSFGDIGGALYGKNMRRIIL
GSIVLSQLGFVSAYIVFTAENLQAFVLAVSNCKSFIDIKFMVLMQLIIFLPLSLIRDISK
LGFTALIADLFILLGLVYLFYYDFLTISTQGVAEIASFNPSTWTLFIGTAIFTYEGVGLI
IPIQESMKHPKQFTGVLAGVMVIITIIFLAAGAVSYAAYGHATKTVILLNLPQDDKLVNA
VQFLYSLAILLSTPLQLFPAIRIMENELFTRSGKYNPGIKWKKNGFRFFLVMICAFVAWG
GADDLDKFVSLVGSFACVPLIYVYPPLLHLKACAETKRQKLADIALTVLGVVSCIYTTAL
TLNNWVNGNNSKAPGYCDS
NT seq 2220 nt   +upstreamnt  +downstreamnt
atggcgtctcccggaaggtacgacaacggggagggttcgtcaactcccaagcttgggtca
tctccgatagcaacctccgcacaccgttcacggtctccagctcccgactccgtaaggcat
gcctcaatagcccggctagcttctccggtgccttcgatatccaactccgtttcctcgaga
caaataccggttccggtttcagtaggcgaatcacaggatctcagcagagtagataacctc
tcgtctctcccaggtcctgggcagtccatgatcgcctctgctcttcaagatagcctcggc
cgatcgcctccgagatttgggaccccaccgagacgtaccgagtcccctgtttccaaccag
aacccgcaaatcaggtcgaattatggctcctttgatcaaaaaccttggagggaagggtcg
gaatactctgcggccccatatgaagacccggagatcgtcaaaaggcacttggtgcagcca
ctggaaagtcgagacactcagtcttccggatacggtacggataacgcagacgatgagttc
tccagcttgcgacttcaaggcggcgacatcaccagacaagtgtacagatgggctgaggat
gcggaagaaggcggatccgtcaggaagcctcagcgcagcagaagcttccacttgaatagg
cctactcccgaagaagataccatgaatattaacagcattcgtgtgccaggcgggtttcga
agagactacttgcgcagggctgtagggagcccgcgtccgggacaatctgatgcaggggac
ggagcatcccctgctccgcgccagcttccaacgagtagctttctagaatttctgacgctt
tacggccactttgcgggtgaggagttggaagaagacgacgaggtacttggtccccacgag
tacttttcctcggacacctgggacgaagcggaagaacgtgagccgggtgaggactctgct
cttcttcatcctgaagcccccggcaagagaagacgcaaacctcgtggaggaacaggaacg
aacacgagaaccggagcggcgcttcttctcctcaaatcattcgtgggcactggggttctt
ttcctgccaagagcgttcctcaacgggggtatgctgtttagcagtctagtactcctcgcc
gtctcgctactaagcttttactgcttcgttcttctcgtgaacgcccggctaaagatcgag
ggttcttttggtgacattggaggcgcgctctatgggaagaacatgcgccgcattatcctt
ggttcgatcgttcttagccagttgggatttgtctctgcgtacattgtcttcacggccgaa
aatcttcaagcatttgtccttgctgtgagcaattgcaagtctttcatcgacatcaaattc
atggtgttgatgcaactgatcattttcctgcccctctcgctgattcgcgacataagcaag
cttggtttcactgcgctcatcgctgatctgtttatcttgcttggtctggtatacctcttc
tactacgacttcctcacaatatccacgcagggtgtggctgaaatcgcttcattcaatccg
tctacatggacactattcatcggaaccgctattttcacttacgagggcgttggcctcatt
attccaattcaggagtcaatgaagcacccgaagcagttcacaggcgtgctggctggcgta
atggttattatcacgatcattttcctggcagcaggcgctgtcagctatgccgcttacgga
catgcaaccaaaaccgtcattctgctcaaccttcctcaggacgacaagctcgtgaatgct
gtccagttcctctactctctagctatacttctaagcactccgcttcagctcttccctgcc
attcgaatcatggagaacgagctcttcacccgtagcggaaaatataaccccggcatcaag
tggaagaagaacggctttcggttcttcctcgttatgatctgcgcgtttgttgcatggggc
ggtgccgatgatcttgacaagttcgtttctcttgtcggtagcttcgcctgcgttcctctc
atttatgtttatccgcccctccttcatctcaaggcctgcgcggagaccaagcgccagaaa
ctcgcagacatagcgctcactgtcctcggagttgtcagctgcatctacactaccgctctg
acgctcaataactgggttaacggcaataattcgaaagctccgggatactgtgactcttaa

KEGG   Aspergillus nidulans: AN7777.2
Entry
AN7777.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K14209  solute carrier family 36 (proton-coupled amino acid transporter)
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN7777.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN7777.2
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ani02000]
    AN7777.2
Membrane trafficking [BR:ani04131]
 Autophagy
  Other autophagy associated proteins
   Others
    AN7777.2
Transporters [BR:ani02000]
 Solute carrier family (SLC)
  SLC36: Proton-coupled amino acid transporter
   AN7777.2
SSDB
Motif
Pfam: Aa_trans EFTUD2
Other DBs
NCBI-GeneID: 2869608
NCBI-ProteinID: XP_681046
UniProt: A0A1U8QPR8 Q5AVA3
Position
IV
AA seq 580 aa
MPEPSLSSSHHGSHHGSQRDEAILSQHLDPQYTAALHEEAILPDNGDGTASNATDVSEPQ
SSLLLQGGDMHRDLYRLDAKTKRARMDKRAATFSAAPRGSDLFEEAVAPLEPGSFRRNFI
RQQGQDHPALHRSFLEYLDLYGNFAGEDLEESEEETEQGEEETQQEAERRPLLGTQRHRR
SRSYRPGDASNVKTFFTLLKAFIGTGIIFLPKAFRNGGILFSSVALVTVALISTLCFHLL
LECRRRYGGGYGDLGEQIAGSKLRSLILSSVAISQIGFVCACIIFTAENLRAFFVAIMPE
TVHSLSTLRLIVLQLVVLIPLTMIRNISKLGPIALLADAFILFGLGYIYCYDIASLASRG
LAPRVDLFNSDSFTLTIGSCIFTFEGIGLILPIQSSMKKPQCFDNLLYTVMFIITVLFTG
VGALSYATFGADTKTEIISNLPQNSRLVNTVQFLYSIAILVGTPIQLFPPVRIIEGNLFG
SASGKRDPGIKWKKNSFRTVAVLACGVIAALGAGDLDKFVSLIGSFACVPLVYIYPAYLH
WKGVAESPWAQRGDIAMMVLGFGFMVYTTAATVSVWVADS
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgccagaaccgtcgttaagctcctcccaccacggctcccaccacggctcccaacgggac
gaggcgatcctctcccagcacctcgatccccaatacaccgctgctctccacgaggaggct
atcctccctgataacggcgatggcactgcatcgaatgctaccgatgtctcggagccccag
tcgtcgctccttctccaggggggcgatatgcaccgcgatctctaccgtctcgatgccaaa
acaaaaagagctaggatggacaagcgagcggcgacgttttctgcggcgcctcgtggaagc
gatctctttgaggaggcagtagcgccgctcgaaccgggcagctttcgccggaactttatc
cgtcagcagggccaggatcatccggctcttcaccgctcgttcctcgaatacctcgacctc
tacggcaattttgcaggcgaggatctggaggaatccgaggaagaaaccgaacaaggagaa
gaggagacgcagcaagaagcggagcgaaggccgttacttgggacacagaggcacagacgg
tcgcgttcgtaccggcctggtgatgcctcgaatgtgaagacgttcttcaccctgctcaag
gcgttcattgggactgggatcatattcctgccaaaagctttccgcaatggagggatcctg
ttctcgtcggtcgctctggtgacggtcgctttgatctcgactctgtgctttcacctgctt
ctcgagtgccggagacggtatggcggagggtatggcgatcttggcgagcagattgccgga
tccaaactccggtcattgatcttgagctcagtagccatctctcagattgggtttgtttgt
gcctgcattatcttcacggccgagaatttgagggcgttcttcgtggctatcatgcccgag
acagtccactcgctgtcgacgctccggttgatcgtgctccagctggttgtgctcattcct
ttgaccatgatccggaacatctccaaactgggcccgatcgcgctccttgctgacgcgttt
atcctgttcgggctcgggtacatctactgctacgacattgccagtttagcgagccgaggg
ctggcgccgcgtgtagacttgtttaattctgactctttcaccttgactatcggatcgtgc
attttcacctttgagggtattggtctgattctgcctatccagtcgtccatgaagaaaccg
cagtgctttgataatctgctctacacagtcatgtttatcatcaccgtcctttttacggga
gtcggagctctctcgtacgccacgtttggcgccgacaccaagacagagatcatcagcaat
cttccccagaacagccgactggtcaacacagtccagttcctgtattccatcgccatccta
gtggggactccaatccaactcttcccgcctgtccgcatcatagaagggaatcttttcggg
tcagcgtccggtaagcgcgatccaggcatcaaatggaaaaagaatagtttccggacagtg
gccgttttggcgtgcggcgttattgcggctctgggcgctggtgatctggacaaatttgtc
tcactgattggatcgtttgcgtgtgtacctctggtgtacatctacccggcgtatctgcat
tggaagggagtggctgagtctccatgggcgcaacgcggggatatagccatgatggtgttg
ggatttggtttcatggtctatactaccgctgcaacggtatcagtctgggttgctgattcg
tga

DBGET integrated database retrieval system