KEGG   Aspergillus nidulans: AN4551.2
Entry
AN4551.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K08502  regulator of vacuolar morphogenesis
Organism
ani  Aspergillus nidulans
Pathway
ani04130  SNARE interactions in vesicular transport
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    AN4551.2
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN4551.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN4551.2
Membrane trafficking [BR:ani04131]
 SNARE
  SNAP-25[C] (Qc)
   STX8
    AN4551.2
SSDB
Motif
Pfam: SIP1 PX RRN3
Other DBs
NCBI-GeneID: 2872351
NCBI-ProteinID: XP_662155
UniProt: A0A1U8QL54 Q5B4H9
Position
III
AA seq 833 aa
MSHKRNFPGSGSGYSPYTKRARSSYTEDDQDDEETQNSVTPYEKPRNHPVFGQKSAFPGL
DTAAGDELFYGPAEDGLEYLRMVRSEANSLPTLFNAPATTESLVENRIVANATSTKPEYT
QQGNVLDEELSTTDRVPEGIYSDGVYIGLATTKVDADENLSDAQASYYNLLHHRFLLLRS
ILKCTPPPEAISALDDSHPISFPRSSKIAQREWRRLIKEVDPQTVQLACMDMDSVLRVLV
IVARLISDNVRNGDAVLIRRIGAWAWGLLAKCRDAGQLGARDIGDIRELGKRAVRILKKI
REEREEMQDEEDDANDYESDAENKIAEGPSGDKGSEAVDISALPDSEHFDAEKKSDAEKL
EQAKARLKARISATESDSISKGGIGTQREVGETAVDVGTLTRAMLDMIITIIGEHYGQRD
LLEARELWTGAEQSFCPYMGINQLPSTSHGAKLQISIPTTTTSTTSPPFTIYNITLRLPL
RSFAVSKRYSDFTTFHTTLISQTNSAPPLPLPPKSWLSNTVTNANLRESRRQGLESYLRA
INEAPDPRWRNSPVWRAFLNLPSLGSNNNSNENITASSARLHAAATGPGFLNGDPILDPR
LWLDCHRDLKSHLHEARLHLTKRDQETTPQRQHESSARAKSSLVRAGSLITALEDGLKRM
ADAGNSNGGTKGRYTSSNSLGEGEIRRRKDLLINARKERDGLENLLNAMAAKSRVDNAVA
SIKDKEALIGAANGTGGGSSRKPARTGRVLGKETERTRELDNQGVLQLQQEMMQQQDMSV
EELLKIVRRQKELGIQINEELEVQNEMLRMVDEDATRLQQKVDIGKKRLGKIS
NT seq 2502 nt   +upstreamnt  +downstreamnt
atgtcgcataaacgcaatttccccggatcaggatctggctactcgccatacacgaagcgt
gcccgctcctcatacacagaagatgaccaggatgacgaggaaacacagaactcagtgacg
ccttatgagaaacctcgcaaccaccctgtcttcgggcagaaaagcgcctttcccggtctc
gatacagcagctggcgatgagctcttttacggtcccgcggaagatgggctggagtacctg
aggatggtccgttccgaggccaactccctgcctacacttttcaacgcacccgcaacgaca
gaatcgttggtggagaacaggatagtggcgaatgcgaccagtactaaacctgaatatacc
cagcagggaaatgtactcgacgaggaactcagtactacagatcgcgtcccagaaggaatc
tattcggacggagtatatattggcctcgccacaacaaaagtcgacgccgacgagaattta
tcagatgcacaagctagttactacaacctcctccatcatagattccttctcttacggtcg
attctgaaatgcacgccaccgcccgaagccatatctgcgctcgacgactcgcaccctatc
agttttccccgatcatccaaaattgcacagagagagtggagacgcctgataaaagaggtt
gatcctcaaacagtgcagcttgcgtgcatggatatggacagtgtcctgagagtgttggtg
atcgtggcgcggctcatatcggataacgtgcgtaatggagatgcagtcctaattcgacgt
atcggtgcctgggcttgggggctcctagcgaagtgccgagatgccgggcagctaggggct
cgagatattggggatattcgtgagttgggaaagcgtgcggtaaggattttaaagaagata
agggaagagcgcgaagaaatgcaggacgaggaagacgatgcaaatgattacgaatctgat
gcagagaataagattgcggaagggccgtcaggcgacaaagggagtgaagctgtcgatatc
agtgcccttcccgactcggagcacttcgatgcggagaagaaatccgatgcggagaagctg
gaacaggcgaaagcacgactcaaagcccgaatttcagcaactgagagtgattcaatatct
aaaggaggaataggaactcaacgcgaagtgggggaaacagctgtagatgttgggacgctg
actcgtgcgatgctggatatgatcattaccatcattggagaacactatgggcagcgggat
ctgttggaggcacgggagttatggactggagcggagcagagtttttgtccatacatgggt
ataaaccagctacctagcactagtcatggggccaagctgcagatctccatcccaacaacc
acaacttctacaacttccccacccttcacaatctacaacatcacccttcgccttcctctc
cgttccttcgccgtctcgaagcgctattccgatttcacgaccttccatacaaccttaata
tcccaaacaaacagcgcgccacctcttccccttccccccaaatcctggctctcaaataca
gtcaccaatgccaatcttcgcgaatcccgccgccaaggccttgagtcctacctccgcgcc
atcaacgaagcaccagatccccgatggcggaactcaccagtttggcgtgctttcttgaac
ctgcctagcctaggcagtaacaataatagcaacgagaacatcactgcatcctccgcccgt
ctccatgccgcagctacaggacctggttttcttaatggagatccaattttagacccaagg
ttatggctcgattgccaccgggatctgaaatcgcatctccatgaagcgaggttacatctc
acgaagcgggaccaagagacaacgccacagagacagcatgagagctcggcgcgggcgaaa
agctcccttgtgcgtgcggggtcgctgataacggccttggaggatggactgaaaagaatg
gccgacgctgggaattcgaatggtggtaccaaggggcgttatacgagctcaaactcgctc
ggtgaaggcgaaatccggcgcagaaaggacctccttatcaacgctcggaaggaaagggat
gggttagagaacctgctgaatgcgatggcggcaaagagtcgtgttgataacgcggttgca
tcgatcaaggataaagaggcgcttataggggccgcgaatgggacgggagggggaagtagc
aggaaaccggcgaggaccgggagggtacttggaaaggagacggagcggacccgcgagctg
gacaatcagggtgtcctgcagttgcagcaggaaatgatgcagcagcaggatatgagtgtg
gaggagttgctgaagattgtgagacggcagaaggagctaggtatccagattaacgaggag
ttggaggtgcagaatgagatgttaaggatggtggatgaggatgccacgaggcttcagcag
aaggttgatattgggaaaaagaggctggggaagatctcgtag

DBGET integrated database retrieval system