KEGG   Aspergillus nidulans: AN4639.2
Entry
AN4639.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K07204  regulatory associated protein of mTOR
Organism
ani  Aspergillus nidulans
Pathway
ani04136  Autophagy - other
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN4639.2
   04136 Autophagy - other
    AN4639.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN4639.2
Membrane trafficking [BR:ani04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    AN4639.2
SSDB
Motif
Pfam: Raptor_N WD40 BBS2_Mid Peptidase_C14 Atx10homo_assoc
Other DBs
NCBI-GeneID: 2872440
NCBI-ProteinID: XP_662243
UniProt: Q5B491 A0A1U8QHI2
Position
III
AA seq 1431 aa
MRDPTVDMEQRNTSPHQASSLQAEAPRRTQKSVRVAFGPDLETHIPPRQRSPAPISNHHR
SFTTVEHHKPPPARPTSSSGENTTPTEGNSRFTSDQDSSSSARPTAALKRAKSDYGPRGG
FDKPVVVDNEDEEDFAMRHGWQEEYTSSEYLKVLHSNFYMYFTEKRHETNGFPRDPVGSW
PSQDWRMKDRLKTVSAALAICLNIGVDPPDVVKTNPTAKLECWVDPTSTTGGGNNKLMEQ
IGKKLQEQYETLSLRTRYKQYLDPSVDETKKFCVSLRRNAKDERVLFHYNGHGVPLPTQS
GEIWVFNKNYTQYIPVSLYDLQQWLAGPSLFVFDVSHAGNIVQNFHTFVEKHEKENLEQK
RLDPNAIVQNYGDCIILAACQKNESLPTNPDLPADLFTCCLTTPIEIALRYFILQNPLQS
NIRIDDFRVPGRLQDRRSPLGELNWIFTAITDTIAWKTLPRALFKKLFRQDLMVAALFRN
FLLSERIMRTYKCQPISSPELPETHNHPLWKSWDLAVEMVLAQLPALIDHEEGRRQYEYQ
HSTFFAEQLTAFEMYLSSGPTEKSPPDQLPIVLQVLLSQAHRLRALILLSKFLDLGPWAV
HLALSIGIFPYVVKLLQSAAQELKPVMVFIWARIMAVDHTVQNDLLKDNGIHYFISILNP
SSPIPVGNASEHRAMCAFIVSIFCKNYTQGQNVCLSSDLFESCLIHLMDVENPLLRQWSC
LCISMLWSDFPEAKWMGIRCSAPMRLCELNFDPVPEVRAAMLHALMTFLGIPDLTDQVAQ
IEESLALAVLPMASDGSVIVRKELLVFFSTFVKRYQNKFLVAAYEELQDEKLNLLGKLGL
DSSPPAETGTAGKPQPLSKNTTFGTIWKQLLILSVDPHPDIAQDAGIIVDYMHQLLLESP
MAALTGRLRKEILDLSNQVDQQSQVREKPNLKKAAPPPPPPTAPPKQEGYLSLSLRRTAS
VAASLKNLAFGGPSQGESSQGSEASTSPQSRAPATPRGRAPPEWTRPPEVNDQLAPATTY
QQAPVPTSRGFERRDSSVAPSIPLYFREPQMKPNEPDEPGSADYNERLWRRSRNEKIISE
TQPLKGKAGSSRWDNSIALLSNATQPLKMCFHQFEDHIAVADDRDTIAIWDWQNHKRLNR
FSNGNPLGSKINEVRYINEDDQALLMTGSSDGVLKVFRNYESAKDVEIVTAFRALPELIP
SNRNAGLVLDWQQGQGKALVAGDVKVIRVWNAATEVCTTDIPARSGSCITSLTSDQVAGN
IFVAGFGDGAVRVFDQRLKPTASMVKVWREHKQWITNVHMQRGGLRELISGSRNGEIRLW
DLRMDNPISTIYGTRDTLRTLSVHEHAPVFMVGTNRHEVKTYNVDGTHLSTFEPYSSFLH
HNRSSPISSTAFHPHRTLFACAALNDNHINLHGRQFVCPALVKQSNGLEYL
NT seq 4296 nt   +upstreamnt  +downstreamnt
atgagggacccgacagtagatatggagcaacgtaatacatcaccgcaccaggcttccagt
cttcaggctgaggccccgaggaggacccagaagtccgtccgagttgcctttggccctgac
ttggaaacgcatatcccacctcgccaaagatcccctgcaccgatttcaaatcaccatcgc
tcatttaccactgtcgaacaccacaagcctccaccggctaggccgacgagctcttctggc
gagaacacaacgcctaccgagggcaattcgcggtttacttcagaccaagattccagtagt
agtgcacggccaacggcggctctgaagagggccaagagtgactatggaccccgcggaggt
ttcgataagcccgtggtcgtcgataacgaggatgaggaggactttgcgatgaggcatggg
tggcaggaggaatacacgtcgagcgagtacctcaaggtgcttcattcgaacttctacatg
tactttacggagaaacgtcacgagacaaatggatttccgagagaccctgttggaagctgg
ccatcccaggactggcggatgaaggaccgcctcaagactgtttctgctgcgttggcgatt
tgtctgaacatcggtgttgatcctccggatgtcgtcaagacaaatccaaccgctaaactc
gaatgctgggtcgacccgacatccaccaccggcggcggcaacaacaagctgatggagcaa
attggaaaaaaactgcaagagcaatacgagacacttagtcttaggacgcggtacaagcaa
tacctcgacccttctgttgacgaaaccaagaagttttgtgtatcgctccgccgaaacgcc
aaagacgaaagagttctcttccactacaatggtcacggtgtcccgttgcccactcagtcc
ggagagatatgggttttcaacaaaaattacacacagtacatccctgtgtccttgtacgac
ctacaacaatggcttgcggggcccagtctttttgtgttcgatgtttctcatgcagggaac
atagtccaaaacttccacacctttgttgagaaacacgagaaagaaaacctcgagcagaaa
aggcttgatccgaatgctatcgttcagaactatggagactgcatcatccttgcggcgtgc
caaaagaatgaatcccttccgacgaatccagatctcccggcggatttgtttacatgctgc
ctgaccacaccgatcgagattgcgttgcgctatttcattctccaaaacccacttcaatcc
aatatccgaatcgacgactttcgggttcccggtcgcttacaggaccgcagaagtcctctc
ggagagttgaactggatcttcacggccatcaccgacacgattgcgtggaaaactctacca
cgagccctcttcaagaaacttttccggcaagaccttatggtggcggcattgttcaggaac
tttctgctgagcgagcgcatcatgcgcacatacaaatgccaaccaatctcatcaccagaa
ctcccagagacccataatcaccccctctggaaaagctgggacctggcggttgaaatggtt
cttgctcagctgcctgcccttatcgatcatgaggaaggtcgcagacaatacgagtatcaa
cattccacattcttcgcggaacaacttactgcgtttgagatgtacttatcatctggccca
accgagaagagcccaccagatcagttacccatcgttctgcaggtccttttgagtcaggcg
cacaggttgagagccctgatcctgcttagcaagttcctcgacttaggaccatgggctgtc
cacttggctttgagcattggtatattcccctatgttgtgaagcttctgcagtcggcggct
caggagttgaaaccggtcatggtattcatttgggcaagaatcatggctgtcgaccacaca
gtccagaatgaccttttgaaggacaacggcatccactacttcatctccatccttaaccca
tcctcacctattcccgtgggtaacgctagcgaacaccgagccatgtgtgccttcattgtt
tcaatattctgcaagaattatacacaaggacagaacgtatgcctatcatccgacctcttc
gaatcctgtttgatacatctgatggatgttgaaaaccccctgctgcgacagtggtcgtgc
ctctgtatcagtatgctgtggtcagactttccggaggccaagtggatgggaattcggtgt
tctgcgccgatgagactttgcgaactaaacttcgaccccgtcccagaagtcagggccgca
atgcttcatgccctgatgaccttcctcggtatccccgatctgaccgatcaggtggcacag
attgaggaatctttagcccttgccgtcctaccgatggcttccgatggtagcgtgattgtc
aggaaagagctccttgtgttcttttcaactttcgtgaagcgctatcagaacaaattcctt
gttgctgcttacgaggaacttcaggatgaaaagctgaaccttctcggtaaactaggctta
gatagctctccgcctgcagagacgggtactgcaggcaagcctcagccactgtccaagaac
acaacatttggcacaatctggaagcaacttctgattctctccgttgatccccatcctgac
attgcgcaggatgcggggataattgtggattacatgcatcagttgttactcgaatctcct
atggccgcgctaactggacgacttcgcaaggaaatattggacctctcaaatcaagttgac
caacagtcccaggttcgtgaaaagccgaatctgaagaaggctgcgccgccgccgcctcct
cccaccgcgcccccgaagcaagaagggtacctctcattgagccttaggcggactgctagt
gtagcagcatcgctaaaaaatctcgcatttggcggcccttcgcagggagaatcatcccaa
ggatcggaggcatcaacatcaccccaaagtcgtgcacctgccaccccacgagggcgagct
cctccggaatggactcggccacccgaggtcaacgaccaacttgctcctgcaacaacatac
caacaagcaccagttcccacttcgcgtgggtttgaacgcagagattcatcagttgcccca
agcattccactatacttccgcgaaccgcaaatgaaacccaatgaacccgacgagcccggt
agcgcggattacaatgaacgtctctggaggcgcagccgcaacgagaaaatcatttcggag
acccagcccctgaaaggaaaagcaggcagcagccgctgggataactcgatagcgctgtta
tcgaacgccactcagcccctaaagatgtgctttcatcagttcgaggaccacattgccgtg
gccgatgatagagatacgattgcgatctgggattggcagaatcacaaacgcctcaaccgt
ttctccaacgggaacccattgggatccaagatcaacgaagttcgttacataaacgaggat
gaccaagctcttctgatgacagggtcgtcggatggcgtgctcaaagtgttccgcaactat
gaatcagccaaagacgtcgaaatcgtgaccgctttcagagcattaccggaactaatccct
agtaaccggaacgccggccttgttctcgactggcagcagggtcaaggtaaagctctggtc
gccggtgatgtcaaagtcatccgggtgtggaatgcggcaacagaagtctgcacgactgat
attcccgcccgctccggctcctgcatcacgtctctaacttctgaccaagttgcgggcaac
atcttcgtggccggctttggcgacggcgcagtccgcgttttcgaccagcgcctcaaaccc
acagcgtcaatggtcaaagtatggcgcgaacataaacagtggatcaccaacgtccatatg
cagcgcgggggcctcagggaactcatctccggcagtcgaaacggcgaaatcagactttgg
gatctgcgcatggataatcccatctcaacgatttacggcacaagagataccctgcgcaca
ctgagcgtccacgaacacgcgcctgttttcatggtcggcacaaaccgccatgaagtaaag
acttacaacgttgacggaacccacctttctaccttcgagccttactcaagcttcctccac
cataaccgctcctcgcccatctccagtacagcctttcacccgcaccgcaccctcttcgcc
tgcgccgcgctcaacgataatcatatcaatctgcatggccgtcagttcgtatgtcctgca
ctcgtaaagcaaagcaacggactcgagtatctctga

DBGET integrated database retrieval system