KEGG   Aspergillus nidulans: AN4709.2
Entry
AN4709.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K00914  phosphatidylinositol 3-kinase [EC:2.7.1.137]
Organism
ani  Aspergillus nidulans
Pathway
ani00562  Inositol phosphate metabolism
ani01100  Metabolic pathways
ani04070  Phosphatidylinositol signaling system
ani04136  Autophagy - other
ani04138  Autophagy - yeast
ani04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AN4709.2
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    AN4709.2
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    AN4709.2
   04138 Autophagy - yeast
    AN4709.2
   04136 Autophagy - other
    AN4709.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN4709.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.137  phosphatidylinositol 3-kinase
     AN4709.2
Membrane trafficking [BR:ani04131]
 Endocytosis
  Macropinocytosis
   Kinases
    AN4709.2
  Rab GTPases and associated proteins
   Rab associated proteins
    AN4709.2
 Endosome - Lysosome transport
    AN4709.2
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    AN4709.2
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_C2 DOCK-C2
Other DBs
NCBI-GeneID: 2872510
NCBI-ProteinID: XP_662313
UniProt: A0A1U8QFD8 Q5B421
Position
III
AA seq 897 aa
MEAFTFAVSAQVDFPIYVKIGSLEGKQKQIPLSVLLKQPELRHIGSVQNPLSDLFVTAQL
WSESKPLGVPLQTSYKAFKTVRAWNEWLQLPISIKDAPLRCQLAITIWDLSPFGGEGANG
HYIPFGGTTIRLFDDDGKLKTGKQKCKVYRHKAADGFSATTTPSTPSKRRRGNKPDPLGP
SPEELELERVEVLIKKHEMEEIPQIDWMDQLVFRQLERLKLSADKAARKRALLMEANRNR
RLESENEEDDEKLEDENFTLYVEFPRFDHPIVWSDHEYPPPPISSYPQNAPGNATGTLKS
LPEVRFGPGIEGADGEEVIRIYDPEVGQTGNPCEDKHRRLIRSHRTGIMDRDLKPNPKIR
DDLNIIMSYEPTQDLTAEEKDLVWRFRYYLTREKKALTKFVKSVNWRDVGEAHQAVEILP
KWTEIDVDDALELLGPTFDNAAVRSYAVERLRKADDDELLLYLLQLVQALKYEDKAHEDA
DIAAHDSSLANFLITRAANNFKLGSYLHWYLMVECDDAGPGTLSSHRRLFARVEYYFMAE
LERMHPEHRKTLLRQGELVAVLSKISKDIRFARENRPIKIEKLKKYLKDPKNDLLQFDPP
LPLPLDPDVMVTGCFPEESNVFKSSLSPLLITFKTTEGRKYPILFKVGDDLRQDQLVIQI
IILMDRLLQKENLDLKLTPYRILATNATAGAMQFIPSTSLSAVSAKYKTVLAYLKANNPD
ENEPLGVRKETMDTYIKSCAGYCVITYLLGVGDRHLENLLLAPDGHFFHADFGFILGRDP
KPFAPMMKLCKEMVEGMGGTSSPLYLQFKQYCFTAYTTLRKSANLILNLFSLMVDANIPD
IRVEPDKAVLKVKERFHLEMTEEEAIRHFEQLIGDSANAIFGVVIDRLHDFVQGWRA
NT seq 2694 nt   +upstreamnt  +downstreamnt
atggaggccttcacttttgcggtttccgcccaagtggattttccgatatatgtcaagatt
ggttcactagaagggaaacagaagcagatcccactctcagttcttctcaagcaacctgaa
ttgcgacatatcggctctgtgcagaatcccctgtccgatctattcgtgactgcgcaatta
tggtcggagtccaagcccctgggggttccattgcagacttcttacaaagccttcaagact
gttagagcctggaatgagtggctacagttaccgatctccatcaaagatgcccctttgaga
tgtcaactcgctattacgatctgggacctgtcgccgtttggtggggaaggagcgaacggc
cattacatcccatttggtgggacgacgatacggctgtttgacgatgatggcaaattaaaa
acggggaagcaaaagtgcaaggtataccggcacaaggccgcagatgggttctcggcgacg
acgacgccatcaactccatcgaaaaggcgaaggggcaacaaaccagatccgctaggtccc
tctccggaagagttggagttggagagagtagaagttttgatcaaaaagcatgagatggaa
gagatcccgcagattgactggatggaccagctggttttccgtcagctggaaaggctgaag
cttagcgcggataaagctgcgagaaaacgtgctcttctcatggaggccaacaggaaccga
cgcctggaaagtgaaaatgaggaggacgatgaaaagcttgaagatgagaacttcacactc
tatgttgagtttccacgattcgaccatcccattgtttggtccgatcatgaatatccgccg
cccccaatctcatcataccctcagaatgcgcctggaaatgctactggcaccttgaaaagc
cttccggaggtccgtttcgggccgggaattgaaggggccgatggcgaggaggtcatcaga
atttatgaccctgaggttggccagacaggcaatccttgcgaagacaaacatcgaaggctt
attcgtagccatcgcaccggcatcatggaccgcgaccttaagcctaaccctaagatacgt
gacgacctcaacataatcatgtcttatgaacctacccaagaccttactgccgaggagaag
gatcttgtatggcggtttagatattatttaacccgagaaaaaaaagctctgaccaagttt
gtcaaatcagtcaactggcgagatgtcggtgaagcgcaccaagctgtcgaaattttacca
aaatggacggaaattgatgtcgatgatgctctagagctccttggtccaacctttgacaat
gctgctgttcgttcctatgctgtcgagcggcttcgtaaggcagatgacgatgagctactt
ttgtatctactccaactcgtgcaagcgctcaagtacgaggacaaagcacatgaagacgcg
gatatagctgctcacgactcctccctggccaactttctcatcactcgcgcggctaacaat
tttaaattaggcagctatttacactggtacctcatggttgagtgcgatgatgccggtcca
gggacactatcctctcaccgtaggctgttcgcccgggtggaatactacttcatggcagag
ttggaacggatgcaccccgaacacagaaaaaccttgctgcgccaaggtgaacttgtcgcc
gtgctctcgaaaataagcaaggatatccgtttcgcccgggagaaccgtcctatcaaaatc
gaaaaactgaaaaagtacctcaaagatccaaagaacgatcttctacagtttgaccccccg
ctgcccctccctttggacccagatgtcatggttacaggctgcttcccggaggaatccaat
gtattcaaatcatcattgtcccctctgctcatcaccttcaagaccactgaaggtagaaag
tatccgatcttattcaaagtcggcgacgatcttcgccaagatcagctcgtcattcagatt
atcatcctaatggaccgcctccttcagaaggaaaacttagacctaaaactcacaccatac
cgcatcctagctaccaacgccacagcaggtgcaatgcagtttatcccgtcaacctctcta
tccgccgtctccgccaaatacaaaacagtgcttgcctacctcaaagccaataatccagat
gaaaacgagccactcggcgtccgcaaggagactatggatacctacatcaaatcctgcgcc
ggctactgcgtgattacatacctcctcggcgtcggtgacaggcatctcgagaatcttctc
cttgcaccagacggacacttcttccacgcagattttggcttcattcttggccgtgacccc
aagccatttgcgcctatgatgaaactctgcaaggagatggttgagggaatgggcgggact
tcttccccgctttacctccagttcaagcagtattgctttacagcatatacgacgctacgc
aagtcagcaaacctcatcctcaatttgttcagcttgatggtagacgccaatatcccagac
atccgtgtagagcctgataaggccgtgctgaaagtgaaagagaggttccatcttgaaatg
actgaagaggaagctatccgtcactttgagcagcttattggggacagcgcgaacgccatc
tttggtgtggttattgaccgccttcatgattttgtccagggatggagagcgtaa

DBGET integrated database retrieval system