KEGG   Aspergillus nidulans: AN4717.2
Entry
AN4717.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
ani  Aspergillus nidulans
Pathway
ani04113  Meiosis - yeast
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN4717.2
  09143 Cell growth and death
   04113 Meiosis - yeast
    AN4717.2
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ani01001]
    AN4717.2
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ani03019]
    AN4717.2
   03036 Chromosome and associated proteins [BR:ani03036]
    AN4717.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     AN4717.2
Protein kinases [BR:ani01001]
 Serine/threonine kinases: AGC group
  PKA family
   AN4717.2
Messenger RNA biogenesis [BR:ani03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     AN4717.2
Chromosome and associated proteins [BR:ani03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    AN4717.2
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kinase-like APH Pkinase_fungal Seadorna_VP7 Haspin_kinase
Other DBs
NCBI-GeneID: 2872516
NCBI-ProteinID: XP_662321
UniProt: Q5B413 A0A1U8QP89
Position
III
AA seq 396 aa
MASGTVGPSPPSGVQGSSASDNSGNPTPGEIHDREKRTVASVRPQTQRHPNPFVITERPE
EKQLGISTRQLSVRDFVLLKTLGTGTFARVWLARLRDDKTRPEKVYALKILRKADVIKLK
QVEHVRNERKTLADVSGHPFITTLIASFSDSQSLYMLLDYCPGGEIFSYLRRARRFNENT
SKFYAAEITMTIEFLHDAEGVVYRDLKPENILLDADGHIKLVDFGFAKQIGDRETYTLCG
TPEYLAPEVIHNSGHGLAVDWWALGILIYEFLVGQPPFWDQNPMRIYEQIVEGHIRYPSN
MSPAAQNIISLLCKTNPAERLGHISGGSARVRTHPFFENINWDDLFYRRIKGPIIPRVDH
PADTGNFEEYPDPDPKSQTIYTEDMRSKYETLFSDF
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggcttcaggaaccgtaggaccctcgccacctagtggtgtgcagggctcatcggcctct
gataactccgggaacccaactcccggagagattcatgacagggagaagcgcacagttgcg
tctgtccggccgcagacacagcggcacccaaaccctttcgtcatcaccgagcggccagag
gagaaacagctggggatctctacccgtcagttgagcgtccgcgacttcgtattgctgaag
accctcggtaccggtacttttgctcgagtatggctggcgagattacgcgacgacaaaacg
agaccagagaaggtctacgcgctaaagatcctaaggaaagctgacgtgatcaaactcaag
caagtcgagcatgttcgcaacgaacggaagaccctggcggatgtgtctggccatccattc
atcacgacattaatcgcctcattttctgatagtcaaagcctatacatgctgcttgactat
tgtcctgggggtgagatattcagctatttgcgccgtgcgcgacgtttcaacgagaatacc
tcgaaattctacgcggccgaaatcaccatgacgatcgaattcctccacgatgccgagggt
gttgtataccgcgacctgaaaccggagaacatcctgcttgatgctgacggtcacatcaag
ctcgttgattttgggttcgcaaaacaaattggcgaccgcgaaacgtacactctatgcggc
actccggagtatctcgccccagaggtgatacacaatagtgggcatggccttgctgttgac
tggtgggctttgggaattctaatatacgaatttcttgttggtcaaccgcctttctgggat
caaaatccaatgcggatctacgaacaaattgtcgaaggtcacatacgctacccttcgaat
atgtcacccgctgcacagaacatcatttccctgctgtgcaaaacgaacccagccgagcgc
cttggacatatttcgggcggctcagccagggtgaggacgcatccgttctttgagaatatt
aactgggatgaccttttctatcgtcgtattaaaggacctatcatccctcgtgtcgaccat
cccgcggatacagggaactttgaagaataccctgatcctgatccgaaatctcagaccata
tacactgaggacatgcgttccaaatatgaaacactctttagcgatttttag

KEGG   Aspergillus nidulans: AN6305.2
Entry
AN6305.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
ani  Aspergillus nidulans
Pathway
ani04113  Meiosis - yeast
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN6305.2
  09143 Cell growth and death
   04113 Meiosis - yeast
    AN6305.2
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ani01001]
    AN6305.2
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ani03019]
    AN6305.2
   03036 Chromosome and associated proteins [BR:ani03036]
    AN6305.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     AN6305.2
Protein kinases [BR:ani01001]
 Serine/threonine kinases: AGC group
  PKA family
   AN6305.2
Messenger RNA biogenesis [BR:ani03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     AN6305.2
Chromosome and associated proteins [BR:ani03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    AN6305.2
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1
Other DBs
NCBI-GeneID: 2871096
NCBI-ProteinID: XP_663909
UniProt: A0A1U8QLU1 G5EB66
Position
I
AA seq 472 aa
MPTLGGLLKKRRTRDSQDLSKELQAGSTTTGHTTTSPIAAEDSQSQQHHGHHGGHHFFHH
NHHNHQPSNNSANSANSQNSHAAKHHQFDQSSATSNQPSDGQTASMQSPAQQPSSTSAHS
NSGHHSNAASIHNIIHPSQQNTPQVSRAERTTKGKYTLDDFAIQRTLGTGSFGRVHLVQS
KHNHRYYAIKVLKKAQVVKMKQIEHTNDERRMLNRVRHPFLVTLWGTWQDARNLYMVMDF
VEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHSLNIIYRDLKPENLLLDRHGHLKI
TDFGFAKEVPDITWTLCGTPDYLAPEVVASKGYNKSVDWWSLGILIFEMLCGFTPFWDQG
SPVKIYQNILAGRIKFPPYLHPDAVDLLSRLITSDLTKRLGNLHGGPDDIKNHPWFAEVT
WDRLLRKEIDAPYVPPIRGGQGDASQYENYQEESEPYGQAGEDPHGHLFPDF
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgcctactctaggaggtcttttgaagaaacggcgaacgagggattcgcaagacctctcc
aaggagctccaggccggttccaccacgactggccacaccacgacgtcaccaatcgctgcc
gaagactcccagtcccagcagcaccacggccaccacggcggccaccatttcttccaccat
aaccaccataaccaccagccttctaacaattcggctaattcggcgaattcgcagaattcc
cacgccgctaaacaccaccaattcgaccagtcttcagctaccagtaaccagccttccgac
gggcaaaccgcctccatgcaatcccccgcacaacagccctctagtacttccgcacactcg
aattccggccaccacagcaatgccgccagcatacacaacatcatacacccgtcgcagcag
aataccccgcaggtgtcgcgggcggagcgtaccaccaagggcaaatacaccctcgatgat
ttcgcaatccagcgcaccctcggcacaggtagttttgggcgcgtccacctcgtgcagtcg
aagcacaaccaccgctactatgccatcaaagtattgaaaaaggcgcaagttgtcaagatg
aagcagattgagcatacgaatgatgagcgacggatgctgaaccgcgtcaggcatcctttc
ctggtcaccctgtgggggacttggcaggatgctcgaaacctctacatggttatggacttc
gtcgagggtggagagttgttcagtctgcttcggaaatctcagcggttccccaaccctgtc
gcgaaattctatgctgccgaggtcactctggcactggagtatctccactcattgaatatt
atttatcgagatcttaagcctgagaacttgttgttagaccgccatgggcatctcaagatt
accgatttcggctttgcgaaggaggtgcctgacattacctggaccctttgcggaacacct
gactatctcgctccagaggtcgtggcttctaagggttacaacaaatctgtcgactggtgg
tccctaggtattctgatcttcgagatgctgtgcgggtttacacccttctgggaccaaggg
tcgcctgtcaagatatatcagaacatccttgctgggagaatcaagttcccaccatacctc
caccccgatgccgtcgatctgctctcccgcctgatcacctcggatcttaccaagcggttg
ggtaacctccacggtggccccgacgacatcaagaaccacccatggttcgcggaagtcact
tgggaccggttgttgaggaaggagattgacgcaccttacgttcccccgatcaggggcgga
caaggtgatgccagccagtacgagaactaccaggaagagtcagaaccctacggccaggcc
ggcgaggatccccacggtcacctgttccccgatttctag

DBGET integrated database retrieval system