KEGG   Aspergillus nidulans: AN4876.2
Entry
AN4876.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN4876.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN4876.2
Membrane trafficking [BR:ani04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    AN4876.2
SSDB
Motif
Pfam: Clathrin Vps39_1 WD40_like zf-RING_5
Other DBs
NCBI-GeneID: 2872678
NCBI-ProteinID: XP_662480
UniProt: Q5B3K4 A0A1U8QXY4
Position
III
AA seq 1280 aa
MDAPGATEASLSRVEPGQGSPTRPSTHHRRPHRQLHTETGDDDEEEQEDPNREREESMTE
TMSYYGEEEEDDEEEEEPHLKCSHLTKQLGSAYRNGDATSTFLAAGDKMVLGTHNGNIHV
FSVPLFRSLRVYHAHSATVTSISISPFPPPAPNLKHELATRFAENQSASTKPFSSSGSIR
GQSKPTSLPTTPSNSIYIASSSIDGNVCVASLLDTKDVLLRNFGRPVQAVALSPEYKSDR
TFISGGRAGELILTTGGKVGVSTNSTTLGGAAATASSWLGTFGLGGNTGKDTVLHSGEGA
ISTVKWSLSGKYVAWVNEEGIKIMRSNLHLDSVDSELAWKRVSHTDRPNRQGWEEMASVW
KARAEWVDESLLESEHLTSNNTGGEASTPTQSTIIKERQEKLVVGWGGTVWVINVYPDRP
NKSNRDLRIGSVEVATILRTDCIISGISLYSPSHLVVLAYIEAENEPADEQITRRRPRGQ
EPELRIIDIESKEEVSADTLAISRYENLTASDYHMSVLPPWKTNMPVSQRGALEALGTGL
WDATMYPARLFSSAASIRSSTSSGDRSSNRAPSTFASRRSVPEEPLAIEVQEVAESSGPK
IFVHSPYDCVAALKRDLADHLAWLIEHEKYAEAWKLLDEHPEAAGSSEGSDNVSITPGRS
QTSLGDLFVDDRSSITATDRGNVPAAVQEKRRIGEMWIEQLIRDNRWQEAARVCVQALSA
TSRWEHWAWTFIKENKFDEITSVIPVDLRPSLSSEIYGAILEHYLTRDRQKFSELFETWP
FELFDIDSITTSIEEQLESEKMTPDLEDGRILIRCLARLYLTGGHYTDALHCYIRIQDAD
AAMALVKDHHLLDSLSDDIPAFIMIRVSKEQLKSAPISELAEITAEPIKLLASEAHTGIV
PPDTVVRQLQTANKPLFLFFYLRALWRGESLSLEAEKPRRGRHRQAATKLAADEGKNLVD
QFADTAAELFAQYERPLLMEFLQTSTSYSFDVAVTICEQYRFTPELIYLLSKMGQTKRAL
NLILSDLKDVSQAIAFAKSQDDPDLWEDLVDYSMDKPRFIHGLLVEAGTSIDPIKLVRRI
PSGLEIEGLREGLTGLLREHDLQASISQGAAKVLQSEVAVGMNTLRDGQRRGIKFNIIQE
SSKSDQVNDEAKAETDSEKTPTPSRGSFTQQAGRCAGCHRPFHANEKEILVAFACGHAFH
LSHVHQSEPSSPAHTPGLESGVQTPRPYPPRTPNLEEPSTTSRTVGPKVTTARLLRDRIG
DGCRICALAKELEAVGDSEA
NT seq 3843 nt   +upstreamnt  +downstreamnt
atggacgcgcctggcgcgactgaggcatcactatctcgggtcgaaccggggcagggatca
cctacgagaccatcgacccatcacagacgcccgcaccggcaacttcacactgaaaccggg
gatgacgatgaggaggaacaggaggatccgaaccgggagagagaagagagtatgacagaa
acgatgtcgtattatggagaagaggaagaagatgacgaggaagaagaagagccgcatttg
aagtgttctcatttgaccaaacagttgggaagtgcctatcggaatggagatgcaacgagc
acttttttggccgctggggacaagatggtgcttggcacacataacggaaatatccatgtc
ttttccgtacctctatttcgctctcttcgtgtttaccatgcgcattctgctactgtcaca
tcaatatcgatttcaccttttcccccaccggcaccgaacttgaaacatgaactggctact
cgattcgctgaaaaccagagcgcgtccacgaaaccattttccagctctggaagcatccgg
ggccaatccaagccgacttctctccctacaactccgtccaactcaatctatatagcaagc
tcatcgatagatggcaatgtatgcgtcgcgtcgttactggacacgaaagatgttcttcta
cgaaactttggtcgaccggtccaggccgttgcgctgtcaccggagtacaaaagtgatcgg
acattcatatccggaggccgtgccggcgaactgattctcacaaccgggggtaaagttggc
gtgagcacaaactccacaaccttgggcggcgcagctgccaccgcctcgagttggctgggt
acttttggacttgggggcaacaccggcaaggacacggttttgcacagcggtgaaggcgct
atcagcacggtgaaatggtcgttgtctggcaaatatgttgcctgggtcaatgaagaaggc
ataaaaataatgcggtcaaatctgcatcttgactcagtggattcggagcttgcatggaaa
agggtcagtcacacagaccgccctaaccgtcagggatgggaggaaatggctagtgtctgg
aaggctcgcgccgaatgggttgacgaatctctcctagagagcgaacatttgacgagcaat
aatacaggaggcgaagcctcaacgccaacgcagtcgacaataatcaaagaaaggcaggag
aaattggtggttggttggggaggcactgtctgggtaattaatgtctaccctgatcggcct
aacaagagcaaccgggaccttaggattggctctgtggaagttgctactatattacgcaca
gactgcattatatccggcatatcactatattcgcccagccacttggtcgtgcttgcctat
atagaagcagaaaatgaaccggcagacgagcaaattacccgtcgtcgtcctcgtggacaa
gagcctgagcttcgtatcatcgacattgaaagcaaagaggaagtcagtgctgataccttg
gcgatcagtcggtacgagaatctgacagcttcggactaccatatgtccgttctgccgccc
tggaaaacgaacatgccagtatctcaacgcggtgcgttggaagcccttggtaccggcctt
tgggatgctacgatgtatcccgcacgactatttagttcagccgccagcattcgcagttca
acaagtagcggagacaggagctctaacagagcgcccagcacgtttgcctcacggcgttcg
gtccccgaggaacctttagccatagaagtgcaggaggttgccgaaagctccggccccaag
atttttgtgcacagcccgtatgactgtgtggcagcactgaaaagagatcttgcagaccat
ctcgcgtggctcattgaacatgagaagtatgctgaagcctggaagcttcttgatgagcat
cctgaagcggcggggtccagtgaaggtagcgataatgtctcaataacgcccgggagatcc
cagactagtcttggtgatctattcgttgacgatagatcttccatcacagcaacagaccgt
ggaaatgtccctgccgctgtacaagaaaagcgacgcattggtgagatgtggatagagcaa
cttatcagagataatcggtggcaggaagccgctagagtttgcgtgcaagcattgagtgcc
acttctaggtgggaacattgggcctggactttcatcaaggaaaacaagtttgacgagatt
acgtccgtcatccctgttgacctacgtccatctttgtcctcagagatctacggggccatc
cttgaacattatcttactcgagatcgccaaaaattcagcgagctttttgaaacttggcct
ttcgagctatttgatattgacagcataacgacttcgattgaggaacaacttgaatccgag
aagatgaccccggacttagaagacggtcgaatactgataaggtgtctggccagattatat
ctgactggcggccactataccgatgcgttgcattgctatatccggatacaggatgcggac
gcagccatggctttggtcaaagaccatcatcttcttgactccctttctgatgatatacct
gctttcatcatgattcgggtgtcaaaggagcagttaaaatcggcgccgatttcagaactt
gcagaaatcacagctgaacctatcaagcttcttgccagtgaagcgcacaccggcattgtt
cctccggacactgtcgtcaggcagctgcagactgctaacaaacccttattcctcttcttc
tatctgcgagcactctggcgaggagaatcgctatcgcttgaagccgagaagccccgtcgt
gggcggcaccgtcaggccgcaactaaactagccgctgatgaaggcaagaaccttgtggat
caattcgctgatacagcagcggaactctttgctcagtatgaacgcccattactcatggag
tttttgcaaaccagcacctcgtattcattcgacgtagcggtgacaatttgcgagcaatac
cgcttcacaccagaactcatctacctgctatccaagatggggcaaacaaagcgcgcttta
aatttgatcctctccgacttgaaagatgtgtcacaggctattgcgtttgcgaagtctcaa
gatgacccagatctctgggaggaccttgttgactactccatggacaagccccgttttata
catggcctacttgttgaagcagggacgtccattgatcctattaagcttgtccgacgtatc
cccagtggattggaaatagagggcctcagggagggtctcactggcttgctaagggaacac
gacctccaggcgagcattagccaaggcgcggccaaggttctacaaagcgaagtagcagtc
gggatgaataccttgcgtgatggccagcgtcgtggaattaagttcaacattatccaagaa
tcttccaaatccgaccaggtgaacgatgaggcaaaggctgagactgattctgagaagact
ccaacgccatcgcgaggttcatttacgcagcaagccggaagatgcgcgggttgtcatcga
cctttccacgcgaacgagaaagagatactcgtcgcttttgcttgcggccatgccttccac
ctgtcccatgtccaccaatccgagccttcgtcgccagcacatactcccgggcttgaatca
ggcgtccagaccccccggccgtacccaccacgtaccccgaacctcgaggagccttcaaca
acgtcgcggaccgttggtccaaaggttacaacagcccgacttctacgggacaggattggt
gacggatgccggatatgtgccctggctaaagagttggaggcagtcggagactcagaggcg
taa

DBGET integrated database retrieval system