KEGG   Aspergillus nidulans: AN5666.2
Entry
AN5666.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K04464  mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
ani  Aspergillus nidulans
Pathway
ani04011  MAPK signaling pathway - yeast
ani04138  Autophagy - yeast
ani04139  Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    AN5666.2
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN5666.2
   04139 Mitophagy - yeast
    AN5666.2
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ani01001]
    AN5666.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     AN5666.2
Protein kinases [BR:ani01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   AN5666.2
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 2871958
NCBI-ProteinID: XP_663270
UniProt: Q5B1B4
Position
V
AA seq 240 aa
MRTENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGRPFFKGRDYVD
QLNQILHYLGTPNEETLSRIGSPRAQEYVRNLPFMPKVPFQRLFPNANPDALDLLDRMLA
FDPSSRISVEEALEHPYLAIWHDASDEPSCPTTFDFHFEVVDDVQEMRRMIYEEVVRFRQ
SVRMPPQAQSLAQQQQIGNIPIPEHQQGVWRQEEPRPQEAGAVGGNHNDLESSLQRGMDA
NT seq 723 nt   +upstreamnt  +downstreamnt
atgcggactgagaacgccggttacatgactgaatatgttgcgacaagatggtatcgcgct
ccggaaatcatgttgagtttccagagctacacaaaagctatcgatgtgtggtccgtaggt
tgcattctggcggagttgttaggtggccgccccttcttcaagggtcgcgactatgtcgac
cagctcaaccagatcttgcactacctgggcactccgaacgaagaaactctgagccgcatt
ggctcaccacgtgcccaggagtatgtgcgtaacttgccctttatgcccaaggtgcccttc
cagcgcctgttcccgaacgccaatcccgatgctctcgatctactcgaccgcatgcttgct
ttcgacccttcgtcacgtatctcggtggaagaggctctggaacacccttaccttgcaatt
tggcacgacgcatccgatgagcctagctgccccaccacctttgacttccactttgaggtg
gttgacgatgtgcaggagatgcgccgcatgatctacgaggaagtcgtccgttttcgccaa
tcggtgcgcatgcccccgcaggcgcaatctctcgcccaacaacagcaaataggcaacatc
cccattcccgagcatcagcagggagtgtggaggcaagaagagcctaggcctcaagaagca
ggcgccgtaggcggcaaccacaacgatctggaatcgtccttgcagcgggggatggatgcg
taa

DBGET integrated database retrieval system