KEGG   Aspergillus nidulans: AN5814.2
Entry
AN5814.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K17607  type 2A phosphatase activator TIP41
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN5814.2
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ani01009]
    AN5814.2
Protein phosphatases and associated proteins [BR:ani01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Other PP2-interacting proteins
     AN5814.2
SSDB
Motif
Pfam: TIP41
Other DBs
NCBI-GeneID: 2870938
NCBI-ProteinID: XP_663418
UniProt: Q5B0W6
Position
I
AA seq 261 aa
MASNSRTASVPIAGNTAAMSPTSQRPDTITVKGFKISTQKLPILKAGPIEAMAKKLGIAP
PEMIFGDNFVSIEHEKSGWSIHFNALDALDRVDKTGESMLEVAHSKEWQKSSTDYKGTVL
SIQGPDFEETSKPIPIELLKRPDPILFFDEVILYEDELADNGITMLSCKIRVMQDRLLLL
SRFFLRLDNVLFRLRDTRVYVDFEKSEVIREYQSKECDYGIVRQKLASARDDIPAIMRDP
NRLSELLPLVDRRLERVVLDG
NT seq 786 nt   +upstreamnt  +downstreamnt
atggcgtccaatagccgcacggcttctgtacctatcgcggggaacacggccgcaatgtcg
cctacctcgcagcggccagacaccattactgtcaagggcttcaagatttcaacccaaaag
cttccaattctcaaggcagggcccattgaagcaatggcgaaaaagcttggtatcgcccca
ccagaaatgatctttggggataactttgtttctattgaacatgagaagagtggatggagc
attcacttcaacgctttggacgccttagaccgcgttgataaaacgggagaatcaatgctt
gaggtagcacattcaaaagaatggcaaaaaagcagtacagattacaagggcactgtattg
tccattcaaggccccgacttcgaggagacctcaaagcccatacccattgaactgctgaaa
cgccctgacccaatacttttcttcgatgaagtaatattgtacgaagatgaactcgccgat
aatggtattactatgctgtcttgtaaaattcgcgttatgcaggacagacttcttcttctc
tcgcggttcttcttgagattagacaacgttcttttccgacttcgggacaccagggtatat
gtcgatttcgagaaatcagaagttataagggagtatcagtccaaagagtgtgattacggc
atcgtcagacagaagttagcaagcgcacgggatgatatacccgctatcatgagggaccct
aacaggctctccgaacttcttccccttgttgaccgacgactagaacgcgtggttctcgac
ggatag

DBGET integrated database retrieval system