KEGG   Aspergillus nidulans: AN5919.2
Entry
AN5919.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K17900  lipase ATG15 [EC:3.1.1.3]
Organism
ani  Aspergillus nidulans
Pathway
ani00561  Glycerolipid metabolism
ani01100  Metabolic pathways
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    AN5919.2
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN5919.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN5919.2
   03029 Mitochondrial biogenesis [BR:ani03029]
    AN5919.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     AN5919.2
Membrane trafficking [BR:ani04131]
 Autophagy
  Cytoplasm to vacuolar targeting (CVT) pathway
   Other Cvt associated proteins
    AN5919.2
Mitochondrial biogenesis [BR:ani03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AN5919.2
SSDB
Motif
Pfam: Lipase_3 Abhydrolase_6 Hydrolase_4 Abhydrolase_5
Other DBs
NCBI-GeneID: 2870991
NCBI-ProteinID: XP_663523
UniProt: Q5B0L1
Position
I
AA seq 590 aa
MDLSVSTLLMSLALVLPSCVSAYQPVYFRSQEATPFIPPQVPSADPQSLSGTHEFTLRHI
VQRGAYEYPELHRRLDIKPNTQLRTVSEDGIEDNEPAVFNVPFVASSEPVTIERLADRRL
SVIEEHLAAARSAGSAVTLSSSQWTKDTLAGPNVTDKKTILTFAKMTANDYIEVPGTEDW
QDINGKLNYSTSFGWQNDGLRGHIYADDTNSTIVISLKGTSPALFDGAGTTTNDKVNDNL
YFSCCCGQGGSYLWREVCDCQKSAFNANLTCIIEAMNDENRYYRASLDLYSNVTELYPNA
NVWLTGHSLGGAMASLLGLTFGLPVVTFEAVPEALPAARLGLPTPPGYNPALPQARKFTG
AYHFGHTADPVYMGTCNGVSSVCTWGGYAMESACHTGQMCVYDTVADKGWRVAIGTHRIK
AVISDVIEVYDDLPQCAPEEECYDCELWKFFRSNGSEITTTSSTTTTSTITTSTRTTTCK
TPGWWGCLDDSTTTDPPTTTTTTSSTCKTPGWFGCKDPTSTTATTTTEAPTTTTTCKDPG
WFGCRDPTSPTTSTAPQTSTCETPGFFWGCYDTQTAVDHLITPAPILIDL
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggacctgagcgtcagcactctgctcatgtctcttgctcttgttcttccgtcttgtgtc
tccgcttatcagcccgtatacttcaggtctcaggaagcaacgccatttattccaccacaa
gtgccttcagctgacccgcaatcattgtctgggacgcacgaatttacccttcgccacatc
gttcagcgaggagcctacgagtatcctgagcttcacagaaggctcgacatcaaaccaaac
acacaactacgaacggtttccgaagatggaatagaagataatgagcctgccgttttcaac
gtacccttcgttgcatcctccgagccggttaccattgagcgactagcagatcgacgttta
tccgtaatcgaagaacacttagcggctgcgagaagtgccggatcagcagtcacccttagt
tcatcacaatggactaaagatactttggcgggaccaaatgttacggataagaagactatc
cttacttttgcaaaaatgacagcaaatgattacattgaggtaccaggtaccgaggactgg
caggatattaacggtaaactgaattattctacgagttttggctggcagaacgatgggctt
cgcggtcatatttatgcagatgatacgaacagcactattgtcatctcgctgaaggggacg
tctcctgcacttttcgatggggctgggacgactaccaacgataaggtgaatgacaatctc
tacttcagttgctgctgtggtcagggcggttcctatctgtggcgggaggtttgcgattgc
cagaaatctgccttcaatgccaatttgacctgcataatcgaagccatgaatgacgagaat
cgatattatcgtgcctcactcgacttgtactccaacgttacagaactatatccgaacgcg
aatgtctggctgacgggccattcattgggaggtgccatggctagtctccttggattgact
ttcgggctgccggttgtcacttttgaagctgtgccggaagcacttcccgccgctcggctc
ggactaccaaccccgcctggatataacccagctttgccccaagcgagaaagttcacagga
gcatatcactttggacataccgcagatcctgtctacatgggaacatgtaatggtgtcagt
tctgtctgcacatggggtggatacgccatggaatctgcatgtcataccggccaaatgtgc
gtttacgataccgttgcagacaaggggtggcgcgttgcgattggtacacatcgcatcaaa
gccgtcatttcagatgttattgaggtatatgatgacttgccgcaatgtgcgccagaagaa
gagtgttacgattgtgagttgtggaagttcttccgaagtaacggctctgagattactact
acgagctcaactacgactacttctaccataactacctcaaccaggacgactacctgtaaa
acccctgggtggtggggctgcttggatgatagcacaaccactgatcctccgactaccacc
actacaacgagctccacctgcaaaactccgggttggtttgggtgcaaggatccgacgagt
actacggcaaccacgacaactgaggcgcccaccacaaccacaacctgcaaggatccagga
tggttcggctgtcgcgaccccacgtctccgacaacctcgactgctcctcagacttccact
tgtgaaaccccggggtttttctggggttgttatgacacccaaaccgcggtcgaccacctc
atcactccagcaccaatccttatagatctttaa

DBGET integrated database retrieval system