KEGG   Aspergillus nidulans: AN6267.2
Entry
AN6267.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K15296  alpha-soluble NSF attachment protein
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN6267.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN6267.2
Membrane trafficking [BR:ani04131]
 SNARE
  SNARE associated proteins
   Others
    AN6267.2
SSDB
Motif
Pfam: SNAP TPR_12 TPR_7 TPR_8 TPR_6 TPR_1
Other DBs
NCBI-GeneID: 2871163
NCBI-ProteinID: XP_663871
UniProt: A0A1U8QXR6 Q5AZL3
Position
I
AA seq 293 aa
MTADPRALLQKADKALQSASGGFSFFGGRTEKYENAADLYTQAANAFRIQKLNKEAGQAF
EKAAAIQTQNLNEPGDAANTLQEAFKVYRKSDPEDAVRVLSTAIQHYVLNGNLRRAASQQ
QYLAEVYEQELGDIKNALEAYEKAAEWFDADNAEALANKHYLKAADLAALESDYYKAIEH
YERIGRSSINNGLMKWSVKDYLLKAGLCHLATQDMVSANRALESYRDIDPTFASTREHQL
LVDLIQTIEAHDQEAFADKLFQFDQLSKLDKWKTTILLRVKNGIEGPEEDDFA
NT seq 882 nt   +upstreamnt  +downstreamnt
atgaccgcagacccccgtgcccttcttcagaaagccgataaagcgcttcaaagtgcctcc
ggtggcttcagcttcttcggtggccgtacagagaaatatgagaatgcagcagatctatac
acacaggctgcgaatgcgtttcgaattcagaaactgaacaaagaagccggtcaagcattt
gaaaaagccgcggccattcagacccaaaatcttaatgagcccggtgacgccgccaatacc
ttgcaagaggcattcaaggtctaccgcaagtcagatcccgaggatgccgtccgtgtgctt
tctactgctatccagcactacgtgctgaacgggaacctgcgtcgggcggcttctcagcag
cagtatctggcagaagtttatgagcaagaattaggggatataaagaacgcgctggaggct
tatgagaaggctgcggagtggttcgatgctgataatgccgaggccctcgcaaacaagcat
taccttaaagctgccgatctggccgcgctggaaagtgattactacaaggctattgagcac
tatgagcgcattggccgctcgtccatcaacaacggtctgatgaaatggtccgtcaaggat
taccttctcaaggccgggctttgccacctagctactcaagacatggtctccgccaaccgc
gcgctagagagctatcgcgacattgatcccacattcgcctctacaagagaacaccagctt
ttagtagacctgattcaaaccattgaagcgcacgaccaggaagcattcgccgataagctc
ttccagttcgaccagctcagcaagctagacaagtggaagacaaccatcttgttgcgagta
aaaaacggaatcgaagggcccgaggaagatgattttgcttga

DBGET integrated database retrieval system