KEGG   Aspergillus nidulans: AN6360.2
Entry
AN6360.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K08329  autophagy-related protein 17
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN6360.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN6360.2
   03029 Mitochondrial biogenesis [BR:ani03029]
    AN6360.2
Membrane trafficking [BR:ani04131]
 Autophagy
  Autophagosome formation proteins
   Atg1 complex
    AN6360.2
Mitochondrial biogenesis [BR:ani03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AN6360.2
SSDB
Motif
Pfam: ATG17_like ALIX_LYPXL_bnd
Other DBs
NCBI-GeneID: 2871254
NCBI-ProteinID: XP_663964
UniProt: Q5AZC0
Position
I
AA seq 588 aa
MSAVDSSTSSGHPEREAQHETGLPPLETLISHLVAAKRSLSAINHVWRANEIVTSARSAL
EESVVVSARTGFLRSGLNNQLRLLYNVRAEVEEISLRGRSEFANALKSLDAADARLKKTL
GLLRETIVHASFRPEGEEPKSLHDFVDERGVEELHSTLKSSIDRTNAAQADLDASNNAFD
VELQSIKQALSTYRATTKLASSRGSVSSSGSQSGSSSSLPSISSMPSMVHSLEMHAQEMA
NLLESLVRHFDLCVTAVKHTEGGGAAAQSITGDMPAGVMGSHPGPGHGAGTGPTIEGDFN
ANPNAPLDPLSASEYREMVSVIVNDAAEAEDVVMEIQDRIGEMESVLETLTAQRDSFAAI
YNATKEVFSYLSSLASTRLPGYIAQAHAFTAVWNDEHDRIKGGLADLSDLNALYDGFLDA
YDGLIIEVARRRHVRHRVEKILRDARNKLDALYEEDVNARETFRVEQGDYLPSDIWPGLS
REPMRVEFHRISGGPLKGVLQSPDQAQSPQPNEGEQLGHQDPQNPGDADSRFGEVIPDLP
QELVEQALARLKTQESVSKDLDDELQHEVLPPDPVQLQTLMYTQSSLM
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgtcagcagtagactcatcaacatcaagcggccatcctgaacgggaagcgcagcatgag
actggcctgccaccgctagaaacactgatctcacacctcgttgcagcgaagaggtccctg
tcagcaatcaatcacgtatggcgcgcaaacgaaattgttacgtctgcccgctcagccttg
gaagagagcgttgtagtgtcagcgcgcaccggtttcctccgcagcggcctgaacaaccag
cttagactgctttacaacgtccgagccgaagttgaggaaatttccctcaggggacgctct
gaatttgcaaatgctctaaaaagccttgatgcagcggacgcgcggctcaaaaagaccctc
ggtttactgcgcgagacgatcgtgcatgcgtcgtttcgccctgagggtgaggaacccaag
agtctacacgactttgtggatgagcggggcgtagaggagcttcactcgacgctgaagagc
tcaatcgaccgtaccaatgccgctcaggcagatctggacgcttccaataatgcctttgat
gttgagctccagtctatcaagcaggcgttgagcacgtaccgggcgacgacgaaactagcg
tcttcccggggttcagtatcttcctcgggctcccagtcaggttctagctccagcttaccg
tctatatcatccatgccgtcaatggtgcattccttggaaatgcacgcgcaggaaatggcc
aatctcctggaatccttggtccgtcatttcgacctctgcgtcacggccgtgaaacacacc
gagggtggcggtgcagctgcccaatccatcacaggggacatgccagccggagtaatgggc
agtcatcccggccctggtcatggcgcaggcacaggcccgaccatcgaaggagactttaac
gcaaatccaaacgccccgctcgaccctcttagcgcgtcggagtatcgggagatggtaagt
gtcatcgtcaatgacgccgccgaggccgaggatgtcgtgatggagatccaagatcgtatc
ggcgaaatggaatctgtgctagagactttaactgcgcaacgggattcgttcgccgcgatc
tataacgctaccaaggaggtcttttcttatttgtcttctctcgcgtcaactcggctaccc
ggatatattgctcaagcgcacgccttcaccgccgtctggaacgacgagcatgatcgcatc
aagggcgggctggcggatctgtcggatctcaatgcgctttacgacgggttcctggatgcg
tatgatggcctaatcatcgaggtcgcgaggcggcggcacgtccggcaccgcgtcgagaag
atcctccgtgatgcaaggaataaattagatgccctgtatgaagaggatgttaatgcccgc
gaaacgtttcgggtcgaacagggcgactatctaccctctgacatttggccggggttgagt
cgggagccgatgcgtgttgagtttcatcgtatttccggtgggccgttgaagggcgtgctt
caatctccggatcaagctcaaagtcctcagcctaatgaaggcgagcaactgggccatcaa
gacccacagaaccctggggatgctgattctaggtttggtgaggttatccctgacctacct
caagaacttgtagagcaggcgcttgctcggctgaagacccaggagtccgtttcaaaagac
ctagatgatgaactacaacatgaggtgttgcctcctgatccagtccaactgcaaacgctg
atgtatactcagtcaagcctgatgtaa

DBGET integrated database retrieval system