KEGG   Aspergillus nidulans: AN6391.2
Entry
AN6391.2          CDS       T01016                                 

Name
(RefSeq) P2A1_EMENI Serine/threonine protein phosphatase PP2A catalytic subunit (Protein phosphatase 2a)
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
ani  Aspergillus nidulans
Pathway
ani03015  mRNA surveillance pathway
ani04111  Cell cycle - yeast
ani04113  Meiosis - yeast
ani04136  Autophagy - other
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    AN6391.2
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN6391.2
   04136 Autophagy - other
    AN6391.2
  09143 Cell growth and death
   04111 Cell cycle - yeast
    AN6391.2
   04113 Meiosis - yeast
    AN6391.2
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ani01009]
    AN6391.2
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ani03019]
    AN6391.2
   04131 Membrane trafficking [BR:ani04131]
    AN6391.2
   03036 Chromosome and associated proteins [BR:ani03036]
    AN6391.2
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ani04147]
    AN6391.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     AN6391.2
Protein phosphatases and associated proteins [BR:ani01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     AN6391.2
Messenger RNA biogenesis [BR:ani03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     AN6391.2
Membrane trafficking [BR:ani04131]
 Autophagy
  Other autophagy associated proteins
   Others
    AN6391.2
Chromosome and associated proteins [BR:ani03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     AN6391.2
Exosome [BR:ani04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AN6391.2
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 2871291
NCBI-ProteinID: XP_663995
UniProt: Q9HFQ2
Position
I
AA seq 329 aa
MDNNMEIDAARSPEPHHLSPTTDPGSIPTLDGWIESLMTCKQLAEEDVRRLCDRAREVLQ
EESNVQPVKCPVTVCGDIHGQFHDLMELFRIGGPNPDTNYLFMGDYVDRGYYSVETVTLL
VCLKIRYPQRITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALIE
NQIFCLHGGLSPSIDTLDNIRSLDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTF
GQDISEAFNHNNGLTLVARAHQLVMEGYNWSQDRNVVTIFSAPNYCYRCGNQAAIMEIDE
HLKYTFLQFDPCPRAGEPMVSRRTPDYFL
NT seq 990 nt   +upstreamnt  +downstreamnt
atggataacaatatggagatcgatgcggcgcgttcgccagagccacaccacctttccccg
acaaccgaccctgggtcgatccccacgctcgatggctggatcgagagtttgatgacgtgc
aaacaactcgcagaggaggatgtgcggaggttgtgtgatcgggcgcgagaggtcttgcag
gaggagtcaaacgtccaacctgtgaaatgcccggtaaccgtctgcggtgatattcacggt
caatttcacgatctaatggagctcttccgtattggcgggccaaacccagacacaaattac
ctcttcatgggtgattatgtcgaccgtggctactactctgtcgagactgttacactcctt
gtttgcctgaaaatccgctatccccagcgtatcaccatcctccgcggaaaccacgagtcc
cgccagatcacacaggtgtacggtttctacgacgaatgcctgcgaaaatacggcaatgcc
aatgtctggaaatacttcaccgacctcttcgactaccttccccttaccgccctcatcgag
aaccagatcttctgtctgcacggtggtctgagtccgtccattgacactctggataacatc
cgatctctagaccgaatccaggaggttccccacgaaggtcccatgtgcgatctgctctgg
agtgacccagatgatcgttgcggctggggaatatctccccgtggtgctggatacacattt
ggacaagatatctcagaggctttcaatcataataacggcctgacacttgttgcacgagca
caccagttggttatggagggatataactggtcacaggaccggaatgtcgttacgatcttc
tctgcccctaattactgctaccgctgcggtaaccaagccgccattatggaaatcgatgaa
cacctgaagtatacgttcttacaattcgacccttgcccgcgcgcaggagagcctatggtc
tcgagacgtaccccagactacttcctgtga

DBGET integrated database retrieval system