KEGG   Aspergillus nidulans: AN6531.2
Entry
AN6531.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K12479  vacuolar protein sorting-associated protein 45
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
ani04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    AN6531.2
   04138 Autophagy - yeast
    AN6531.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN6531.2
Membrane trafficking [BR:ani04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    AN6531.2
SSDB
Motif
Pfam: Sec1
Other DBs
NCBI-GeneID: 2870221
NCBI-ProteinID: XP_664135
UniProt: A0A1U8QKI7 G5EAX3
Position
I
AA seq 593 aa
MDVVAAVSGYISKMVTAGDPSAGGSSTAKMKILLLDSETVPIVSTAITQSALLNHEVYLI
DRLDNNARERMRHLRCLCFVRPSATSIQLLIDELREPKYGEYYIYLSNIIRKSSLERLAE
ADVHEVVRVVQEHFADFLVINPDLCSLNLGYPNQRLWANSPDVWNADALQRSTEGVIATL
LSLKKNPLIRYEKNSLLAKKLATEVRYQITQEEQLFNFRKTDTPPILLILDRRDDPITPL
LTQWTYQAMVHELIGIQNGRVDLRDVPEIRPELREIVLSQDQDPFFKKNMFQNFGDLGQN
IKEYVEQYQVKTKNTMNIESIADMKRFVEDYPEFRKLSGNVSKHVTLVGELSRRVGEENL
LDVSELEQSLACNDNHNSDLKTLQRIIQLPTVPPENKLRLVALYAIRYEKQPSNALPVLL
DLLVTAGGVPSHRVNIIPKLLAYHHSLQAPPIAGGFSDLFESTSLFSGARDRFKGLKGVE
NVYTQHSPRLEATLQNLIKGKLKELQYPFLEGGGHVRDKPQDIIIFMVGGTTYEEAKMIT
QVNASSPGIRVVLASTSVHNSKSFLEEVDDAVSGWPESEPSTAAGRLRRNIGR
NT seq 1782 nt   +upstreamnt  +downstreamnt
atggacgtcgtcgctgcggtgtccgggtacatctcaaagatggttaccgcgggtgatcca
tcggcgggtggctcctccacagccaaaatgaagatactactccttgacagtgagacagta
ccaatcgtctcgactgcgattactcaatccgccctgctgaaccatgaagtatacctgatc
gatcgactggacaacaatgcccgagagagaatgagacatctacggtgtctttgcttcgtc
cgaccctctgcaacgtccattcagctcctaatagatgaactgcgcgaacctaagtacggc
gaatactatatctacctaagcaacatcatccgtaaatcttccctcgagcgtctggcagaa
gcggatgtccacgaagtggtgcgggtcgtccaggaacatttcgcggactttctcgtgatc
aacccggacctttgctccttaaatctaggttatccgaaccagcggctctgggccaactcg
ccagatgtatggaatgcggatgcgctacaaagaagcacggagggtgtgattgcaacgctg
ctttctctaaaaaagaacccgctcattcgttacgagaaaaatagtttattggcgaaaaag
ttagctacagaggttcgctatcaaattacacaggaggagcaactcttcaacttccgcaag
accgatacccctccgattctacttatccttgatcgccgcgatgatcctataacccccctt
cttacacaatggacatatcaagcgatggtgcatgagttaataggcatccaaaatgggcgg
gtcgaccttcgagacgtgccagaaatccggcccgagttacgggaaattgttctttcgcag
gaccaagaccctttctttaagaaaaatatgtttcagaactttggagatcttgggcaaaat
atcaaagaatacgtggagcagtatcaggtgaagactaagaacactatgaacatcgagtct
attgccgatatgaagcgtttcgttgaagactatcccgaattccgaaaactttcaggcaat
gtgagcaaacacgtcacactggtcggggaactcagtcggcgagtgggtgaggaaaacctt
ctcgatgtgagtgagttggaacaaagtctggcttgcaatgacaaccacaatagcgaccta
aagactctgcaaaggatcattcaattacctacagtgccccctgagaataaattgcgacta
gtggctttatatgctatcagatatgagaaacaaccgtccaatgcccttccggtccttctt
gatcttcttgtgacggccgggggtgttccttctcaccgagtcaacattataccaaaatta
ctggcctaccaccactctctccaagctccgccaattgccggcggattctctgacctcttt
gagtccacatcgttgttttctggtgctcgcgacagattcaaaggcttaaaaggcgtcgag
aatgtctatacccagcattcgccgcgcttggaagcgaccctccaaaatctgatcaaaggc
aaactcaaagagcttcaataccccttcctcgaaggtggcggtcatgttcgggacaagcca
caggatattatcattttcatggttggcggaacaacatacgaggaggcaaagatgataact
caggtcaacgccagctcacctggtatacgggtagttttagccagcacgtctgtccacaac
agtaagagtttccttgaagaggtcgatgatgctgtgagcggatggcctgagagtgaaccc
tccaccgccgctggacggcttcggaggaatattgggcgatag

DBGET integrated database retrieval system