KEGG   Aspergillus nidulans: AN6720.2
Entry
AN6720.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K20183  Vam6/Vps39-like protein vacuolar protein sorting-associated protein 39
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN6720.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN6720.2
Membrane trafficking [BR:ani04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    AN6720.2
SSDB
Motif
Pfam: 6PF2K His_Phos_1 Vps39_1 HbrB Vps39_2 CNH Clathrin AAA_33 KTI12
Other DBs
NCBI-GeneID: 2870343
NCBI-ProteinID: XP_664324
UniProt: Q5AYB0
Position
I
AA seq 2440 aa
MSSKTFFASSDDTKICVVMVGLPARGKSLIAGKAMRYLGWVGIPARVFNVGTYRRSATPQ
PDANFFDPHNSEGEKMRRAAAEAAMTDMIQWFNSGKGVVAILDATNSTRKRRKWIYESCR
EANIETLFVESICDDEDLIMNNILEVKTTSPDYKGQDPEVAALDFRNRIRNYEKVYEGIG
DDENHYTYVKLINVGSTVIINQIKDYLSSRLVYYIQNLHIKPRSIWLSRHGESEYNLTGK
IGGDSSISERGEAYARALPGLLKKSGVPPNTKIVIWTSTLKRTIQTARHLAAETGYEKLE
WKALDELDSGVCDGLTYEEIAEKYPEDFAARDEDKYNYRYRGGESYRDVVIRLEPIIMEL
ERSENVIIVTHQAVLRCIYSYFLNVAQEQSPWMEVPLHTLIKLTPRAYGTEEQRFKADIP
AVSTWRAKGTSAKHQDFPTEMKAKFEFNGSVFVPTHRFESSRRRAMLSAFTARPLVELKP
RDKSRIEAVLAYGDRVLVGLNNGNLRVYRVNEVEIEAEHDADPPPTQNNGNGHDAGYGGS
RPPTQNGNGDNGTNNPVAKAKRTDLLRELEKFSRYKIEQLAIIKEAKLLVSLSGGYVSIH
DLQTYELQEQLTRTKGAVAFAVTSNIVNDPETGVPSIVSRLAVAVKRKIMLWSWRDMELE
NDTAELTLVSGIKTLTWVSGTRLVAGLSSNFVLVDIEMKTVTDLVGPGSIGGLGGQETGR
LAGVGVASMSYIGIGGSAPKPLATRLSEGQILLAKDINTQFTDIDGNSLGRRQIPWSSAP
ADIGYSYPFLLALHDSMKGILEVRNPETLSLLQSISLPSASTMHIAQPTISLAHAGKGFL
VASDRIIWRMEALGYDSQIDSLVEKGYLDEAISLAGMLEDALLKNKEGRIREIKLEKAEG
MFRLRRYLESMELFTEVSAPPETVIQLYPRIIAGDLTSISEEDELEGSMTESQSKLPDSQ
AQAEGNGSEETTPIKALNHTPSMMSFLRSRDEGSGSDSGSVRGKPEEARLEKPLTGKDLK
LAVRELQAYLADVRRRFQRFLNPDGSLKIDPQTHAAKDEYTDSVMKLLDVGEDDEDYDLG
EKLREKARLVDTTLFRVYMYATPSLAGSLFRIANFCDPEVVMEKLEETGRHNDLIDFLYG
KKMHRQALELLRKFGQSESEEETAPQLHGPKRMVAYLQHLPPEHIDLILEFSEWPIREDP
DLGMEIFLADTENAETLPRQKVLDFLQGIDDKLAVRYLEHVIGELNDLTPDLHQRLAVLY
LNRLQKHQNSKDGFATEDEYKFWREKLITMLKTSDQYSPSKILARLDRDDPEFFEARAIL
FSKMGQHRQALEIYVFKLEDYVKAEEYCNHLHRTEDTPTPSGPAAEYSALAPSDDEPSIY
HTLLSLYLTPPHGYKPQYAPALDILARHGSRLPANSALDLIPESLPVHELEFYFKGRMRA
ANTILNESRITANLLKVQTIKTRAELLVGEGTDGRSSRSRHVTITEERVCSVCHKRIGGS
VINVFPEAGLSFLIPRIPVVLEAAIQEGKRGKREKLMAGRASSGSQSSVAEQTNDRQEYL
TIAWPAGLLGYCVNLSGIDSNHQIQISQHDNVCIVKNELLAVLITYSAPNLHRHCPLLEM
LRSPVTVSPERSASRPPLPRSSSDFDDDPDRPGSSGSDASSVISNATAFQTTPHRRDRDR
DREPDPSYSPRTVLRTPPTETSAAASASAQGPGHPPTSFMPHHDPTSRKPSGRVYPSDLH
KRSRHHSQGFFEPSLPTASSSDATLSASRIAAQAAMQSQGQHSSSTIPQVPPKRAVQGHG
SDNGSGSVSPPPPIPASQPQRPGSAGSPYQNSNATTGGHGVGQAAATTAANHVFPRLPPP
GVEAHPNEREHKKTEKEKSKMKLFSKPKHIGISRDKDFKDRGLPSPNKISGLTRIVSASA
TNLADIYPSNNSSMYSLSNASASTVVPADKPSVPEKEKDKEKDKEKDKEKAHRHHHFLSR
QKLKLKDLKDKDDHYNLPLSSAASNSRPSDPNAPQSLYSFTPASPSATTTSFSKSVGGLD
LLHGGRALRDKKKEEKTLAEEQPEWLANSTVAGAATAGFAGPSSLGSTGGFLTEAVVRET
LQGFGLHNMSPEDAWDFLKAKLLVIFDGEDVRIAIEDLNKLVIIHIQRCVQRRTPTAIVD
DLRGLLEAGFATLNHTLNGVPDDKLVPHLVQIWMLMNIREAKNFWSLALDGEYPGCELEV
RNLVLIAFRDMVIINRYDNLKATFSRLSLDSIKLGNSALSVTTKSSNNSNNGRPTTSASF
DGGFGSYSSQSSTFLNTAGSFSSESPGYNRSRATSNTSSNPDQLIFQSFSSPSQRPTIIH
RANNASDTSHVITETVGRMLQCMSVLASVQTNDTAQERIETLSKDLKHNWLGRGRTGRDR
RGFVGTKIRPPIVAQASDNSTDSNMDELSSKRLQQELSVL
NT seq 7323 nt   +upstreamnt  +downstreamnt
atgtcgtccaagactttcttcgccagctcagatgacacaaagatatgtgtcgttatggtc
gggttgccggccaggggcaagagtctaattgctgggaaagcaatgcgatatctgggctgg
gttggcatcccagctcgtgtattcaatgtgggaacataccgcagaagcgccacgccacag
cctgacgctaactttttcgatcctcacaactcagaaggggagaagatgaggcgcgctgcg
gccgaagcggccatgacagatatgatccagtggttcaattctggcaaaggcgttgtagcc
atactcgatgctacaaattcaacaagaaagcgacgcaagtggatttatgagtcatgccgc
gaagccaacattgagacgcttttcgttgaatcaatatgcgacgacgaggacctgatcatg
aataacatcctggaagtgaagaccacgtctccagattacaaggggcaggaccccgaagtt
gcagcgctagacttccggaaccggattcgaaactatgagaaagtttatgaggggattggc
gacgacgagaatcattacacctacgtaaagctgattaacgtcggctctaccgtgatcata
aaccagatcaaagattacctatcaagtcggttggtctattatatccaaaatcttcatata
aagccacgatccatatggctttctcgtcacggagaatcggaatataatctgactgggaag
attggtggagattccagcatctctgagcggggggaagcttatgctcgagctctgcctggc
ctactgaagaaatcaggtgtgccacctaatacgaagattgttatttggacgtcgaccctc
aagcgcacaatccaaacagctcgccaccttgccgccgaaacgggctatgagaagctagaa
tggaaggccctcgatgagcttgactcgggtgtttgcgatggtctcacatatgaggagatt
gcagagaaataccctgaggactttgcggcccgagatgaggacaaatataactaccgttat
cgcggaggcgagtcttaccgagacgtcgtgattcgccttgagccgatcatcatggagctg
gaacggagtgagaatgtcattatcgtcacacatcaagcagtcttgcgctgcatctactca
tactttctcaacgtcgcccaggagcaaagcccatggatggaggtgcccttacacactctg
atcaagctcacgcctcgcgcatacggaactgaagaacagcgtttcaaggccgacattccc
gctgtatccacgtggcgggctaaaggaacatctgcaaagcaccaagactttcccactgag
atgaaggccaaattcgagtttaacggttctgtatttgttccaacacatcgttttgagtct
tctcgccgccgagccatgctctccgcattcactgctcggcctctcgtcgagctcaaaccg
cgagacaagtcgcggatcgaagctgtcctcgcatacggcgatcgggtcctcgtcggactg
aataacggaaatttacgggtctaccgcgttaacgaagtcgaaattgaagctgaacacgat
gcggatcctcctcccacccagaacaacggcaacggccatgacgcaggttacggcggaagt
cggccgcccacacagaatgggaacggggataacggcacgaataacccggtagcaaaagcg
aaacgtacagatctactccgtgaattggagaagttttctaggtacaagatcgagcaactg
gcgataattaaggaggcgaagctcctggtctccctgtcgggcggatatgtctccattcac
gatttacaaacctatgaactccaggagcaacttacacggaccaaaggtgccgtagctttc
gccgtgacatcaaatatcgtcaatgatcctgagactggtgttccgtcgattgtatcgcga
cttgcggttgcggttaagagaaagataatgctatggtcgtggagggacatggaactcgag
aatgataccgcagaattaacactcgtcagtggtataaagacgcttacgtgggtctctggt
acgagactggtggccggactaagctcgaattttgtgctggtagatattgagatgaaaact
gttacggatttggttggcccagggagcatcggcggtcttgggggccaggaaacagggcga
cttgcgggtgtcggagtcgctagtatgagttacattggaataggcggttctgcgccgaaa
ccgctggccacacggctgagcgagggacagatattgttggccaaggacattaacacgcag
tttactgatatcgatggaaattcgttgggtcgacgacaaattccctggagcagcgcgccg
gccgatattgggtattcgtatccattcttgcttgccctgcatgattctatgaaggggatc
ttagaggttcggaacccggaaactctgtcgctgctccagtctatttctctgccttccgca
agcactatgcacattgctcaacctaccataagcctcgcgcatgccggcaaggggttcctt
gtagcgagtgaccgaatcatatggaggatggaggctctcggatacgacagccagattgac
tcgcttgtggagaaaggctatcttgacgaagctataagtcttgcgggtatgcttgaagat
gcgcttctcaagaataaagaaggcagaatacgagagattaaactcgaaaaggccgaggga
atgttcaggctacgaaggtacctcgaatcaatggagctctttacagaggtctccgcaccc
cctgagaccgtcattcaactgtaccctaggattatcgcgggcgacctcacgtctattagc
gaagaagatgaattggaaggaagcatgacagagagccaatctaaactccctgatagtcaa
gctcaggctgaaggaaacggctcagaagagacaacacccatcaaagctttaaatcatacg
ccgtcaatgatgtcttttcttcggagccgagatgaagggagcggaagtgactcaggcagc
gtccgtggaaagccggaagaggcacgtcttgaaaagcctctaaccgggaaagatctcaaa
cttgcagttcgtgagctacaggcatatcttgctgacgttcgaagacgattccagcggttc
ttgaaccccgatggctcactcaagattgacccgcaaactcatgcagcaaaggacgaatat
acggattctgtgatgaagttactcgacgtaggcgaggatgacgaagactacgaccttgga
gagaagcttcgcgagaaagcaagacttgttgatacaaccctcttcagagtttacatgtac
gccacaccttctctagcaggctcgctcttccgcattgccaacttctgtgacccagaagtg
gtcatggagaaactcgaagagacaggccggcataacgatctcattgactttctgtacgga
aagaagatgcaccgccaggctcttgagcttctcaggaaatttggccagtctgaatcagaa
gaagaaacagcgccgcagcttcatggacccaagagaatggtcgcgtatctgcagcatcta
cccccggagcacattgaccttattcttgaattctccgagtggcccatccgggaggaccct
gaccttggcatggaaatcttccttgcggatacggagaatgcggagacgctgcctaggcaa
aaagtacttgattttcttcagggaattgacgataagctggctgttcgttatcttgagcat
gttattggagaactgaatgacttgacgccggatttgcatcaaaggctggctgttttgtat
ctgaaccggttacagaaacaccaaaacagtaaggatggattcgcaacagaagatgaatac
aaattctggcgggagaagctcattacgatgctaaaaacgagcgaccagtactcgccgtct
aaaattctggctcgtctggatcgtgacgacccagagtttttcgaagctcgcgcaatccta
ttcagcaaaatgggtcagcacaggcaagcactggaaatttacgtattcaagctagaagat
tatgtcaaagcagaggaatattgcaaccatctccacagaacagaagataccccgacaccg
agtggaccagctgctgagtattccgcgctggccccctccgacgatgagccctccatctac
cacacactgttgtcattgtacctaactccgcctcacgggtataagccacaatatgctcca
gctcttgatatccttgcccggcacggatctcggttacccgccaattctgcattagacttg
atccctgaatctcttccggtccacgaactcgaattttacttcaaaggccgcatgcgcgca
gcaaacacgattttgaatgaaagccggatcacggcaaacttgctcaaggtccaaaccatc
aaaacacgcgcggagctgctagtcggcgagggaacggatggaagatcgtcaaggtcaagg
catgtcaccattaccgaagaacgggtgtgcagcgtctgtcataaaagaattggtggtagt
gttataaatgtatttcctgaggcgggtctttcgttcttgatacccaggatacctgttgtt
cttgaagctgctattcaggaggggaaaagaggaaagagggagaaattgatggcggggcga
gctagcagcgggagtcagtccagtgttgcggagcagacaaacgatcgacaggaataccta
acgatcgcctggccggctggtcttctaggctactgtgttaatctctctggaatagattcg
aatcatcagatccaaatcagtcaacatgacaatgtctgcatagtgaagaatgaactcctt
gctgtcttgattacatactcagccccgaacctccaccggcactgcccgctgctggaaatg
ctgcgctcccccgtcaccgtctctccagagcgctcagcctctcgaccaccgctccctcgt
tcctcttctgacttcgatgacgacccagaccgtccaggctcctccggaagtgatgcctcg
tcggtgatctcaaatgcgactgcattccaaaccacccctcatcgccgcgaccgcgaccgc
gaccgcgaaccggatccgtcctactcccctcgtaccgttcttcggacaccacccaccgaa
acttcagccgcagcctcagcctcagcgcaaggcccagggcatcccccgacttcattcatg
ccgcatcatgatcctacgagcagaaagccgtctggacgagtctacccgtcggacctgcac
aagcgctcgcggcaccactcgcaggggttcttcgagccgtccctgcccacggcttcgtca
tctgacgcgacgctttcagcgtctaggatagcagctcaggctgctatgcaaagccagggt
cagcattcgtcttctacgatccctcaggttcctccgaaacgggctgtgcagggacatggt
tcagacaacgggtcaggatcggtctcaccacctcccccgattccggcttcccagccgcag
agacccgggtctgcaggctcgccatatcagaactcgaatgccactaccggagggcatggt
gtagggcaggctgcggcgacgacggctgccaaccatgtctttccacggctaccgccgccg
ggagtggaagcacatcctaatgagcgagaacataagaagactgagaaggagaagtcgaaa
atgaagcttttttcgaagccgaagcatattggcatcagtcgtgataaggactttaaggac
aggggactcccgtcaccgaacaagatttccgggctgacacggatagtcagtgcgtctgcg
acgaatcttgcggatatctatccgtcgaataactcgtctatgtatagcctgtcgaatgca
tcggcgagcactgttgtaccggctgataagccttcggtacctgagaaagagaaagacaag
gaaaaggacaaagaaaaggacaaggaaaaggcccaccggcatcatcatttcttgtcgcgg
cagaagctgaagctgaaggatttgaaagataaagatgatcattacaacctgccgctctct
tctgcggcgagtaactccagaccgtcagaccctaatgctccgcagtcactatactctttc
actccggcttccccgagtgctactactacttctttcagcaagtctgtaggcgggttggat
ctattacatggtgggcgagcgctccgcgacaagaagaaggaagagaagacgcttgcagaa
gaacagccggaatggttggcgaattcgacagtcgctggggcagctactgcagggtttgct
gggccgtcatcgttaggaagtactgggggcttcctcactgaggctgttgtacgggaaacg
ttacaaggctttggtcttcataatatgagtcctgaagatgcatgggacttcttaaaagca
aaactgttggtgattttcgacggcgaagatgttcgcattgcaattgaggatctgaacaaa
ctagtgatcatccatattcagcgctgcgtgcagaggcgtacgccgacagctatagtcgac
gatctacgcgggctgctggaagctggctttgccaccttgaaccataccctcaacggcgta
ccggatgataagctggtgccccatctcgtgcagatctggatgctaatgaacatacgagaa
gcaaagaacttctggagcctcgcgctagatggggaatatcccggttgcgagctcgaagtc
cgcaacctcgttcttatcgccttccgcgacatggtcatcatcaaccgctacgataacctc
aaagccaccttctcccgcttgagccttgacagcatcaagctcggcaactccgcccttagc
gtaacaacgaaaagcagtaataatagcaataacggccgccctacgacctccgcatccttc
gacggcgggtttggcagttacagttcccaatcatccaccttcctaaatacagccggcagc
ttttcttcggaatccccaggatacaaccgcagtcgtgctacctccaacacctcctcaaac
cccgaccaactcatcttccaatccttctcttccccttctcaacggcccacgattatccac
cgcgcaaacaacgcatcagatacatctcacgtcatcaccgagacagtcggccgcatgctc
cagtgcatgagtgtcctcgcaagtgtgcagaccaacgatactgcgcaggaacgaattgag
acactcagcaaagatctcaagcataactggttgggacgcggccggacaggaagagatagg
cgtggttttgtggggacgaagattcgcccgccgatcgttgcacaggcgagcgataactct
actgattctaatatggacgagttgagttccaagaggttgcagcaggagttgagtgttttg
tga

DBGET integrated database retrieval system