KEGG   Aspergillus nidulans: AN6880.2
Entry
AN6880.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K07756  inositol-hexakisphosphate 5-kinase [EC:2.7.4.21]
Organism
ani  Aspergillus nidulans
Pathway
ani04070  Phosphatidylinositol signaling system
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    AN6880.2
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN6880.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.21  inositol-hexakisphosphate kinase
     AN6880.2
SSDB
Motif
Pfam: IPK Pam17
Other DBs
NCBI-GeneID: 2870582
NCBI-ProteinID: XP_664484
UniProt: A0A1U8QLF6 Q5AXV0
Position
I
AA seq 1357 aa
MSRPPSASETTPSTPPVTPAASAQHDCSGRPSSLHSKQRRHRDVRDQLVHIDPQHVPSPS
RAESPTARQWANPSSNSTLKRAKTTASDTLSRPGLSYTGYNSPQLSERDSIFATHYLPSD
NEAASSPQLPPVEAAYHDVPSKLNSDNASPSSFTPKALSYQHRGDDAHMEVDVRRTQPLR
SAPLLPSDTPFTISPSDSDVGLDEDLDSSTRRPQKHTLDNIAPYRKSSLHLPGAGAAASA
PPHGLHPSPVIDGTSRPQELMVTSDKRATNASPGGSSHQKQGQSPWDFAKGPKVERSSSR
SRRGRVENSIEADITNAEHAPYVRSRKSSHYLGLFKENTATSPDRKRRDDRSARHDNSSE
SRGREQHGPHAEHRHSRDDQYEADSFKRPEVQGSKRLSQLSLANIPMIKPFAGGDSQEDY
TAEHVPAKSEQKRLPRSLLEEIRNFHLTPGGARGTSFSRSIPTQYSERSKAFHPRSPFSD
TEEPHVGSGPLDDEEDEQISSAVYFPHERVTVSGEVDPLQSIEVHPRDLHSFDESATEGS
LVLKPERLTAPDEPETNHVDISLRSKNDSRILHGDLQDRKTPIEELNEKSIDSMLQRQTE
YSTEESEAFSADDSGTSVRDEESSVTDEAEVTPTATPTQRPHIPRPRRKQGAVTPVGAVE
LKPYRHQVGGHTTVFRFSRRAVCKQLNNRENEFYERIERRHPEMLMFLPRYIGVLNVTFS
KKRSKKSSEAQLEQSDVDATDDPQNKNTVATTGHSLHEAANSVEKERIFSQKQVTGIVPK
VILENNRHIIPVDLFSHKRPRTATAALSDMRPSSNGAGRTTNQRNHEHGSLDEKLSHSPA
KKTWGATTVNRKLQEQVLREVFSPPAIHHHRRHARGLLNLPRTTSDGHRRSANLSEGLIT
RQPRIMEQMEPPRSPAIDIVKKGSDGPGLSSSASTALEGGQQHLESVRSEEAVPRSSSVS
RTRRVRRRHSGSGLQRRGTMDSDKGGGELIFFEDEGYGGDKEDEIFSMESDAPTSSTTPG
EARLSSSSPSKGSDLIPQDRWTSGGPVVESSKSPAFPGFNDNILSQPPANPKEAQTRKDD
RVQFFLLLEDLTAGMNKPCVLDLKMGTRQYGVEADDKKRKSQRRKCQNTTSQQLGVRLCG
MQTWNVKKQEYIFEDKYFGRDLKSGREFQDALTRFLYDGVSYLSVAKKIPIILDKLAKLE
NMIRKLKRYRLYASSLLILYDGEQNPQHKASQHEAASNDNARNHLQRRTSEDGHNNTDVS
LKIVDFANCVTGEDELSPNARCPPQHPDDIDRGYLRGLRTLRMYFQRIMKEVSQDEYLER
GEGEGIALNPQSSSNNPTSDRYWDESVMDQDPGEVSF
NT seq 4074 nt   +upstreamnt  +downstreamnt
atgtcaaggcctccatctgcatctgagactaccccctcgactcccccggtgacacctgct
gcttctgcccaacatgattgctctggacgcccgagctctctacatagcaagcagcggcgc
caccgcgatgttcgggaccagctcgttcatattgatcctcaacacgttccctctccatcc
cgcgctgaatcccccacggctcggcagtgggccaacccctcgtccaattctactctaaaa
agagctaaaaccactgcttcggacaccctctctcgtccaggtctgtcctataccggttac
aacagccctcagctgtctgaaagggacagcattttcgcaacacattatcttccttctgat
aacgaagctgccagttcaccgcaacttccgcccgttgaagctgcctatcatgatgttccc
tcaaagctgaactctgacaatgcctctccttcctcgtttactcccaaggccctctcctac
caacatcgcggcgacgacgcacacatggaagttgacgtccgcagaacacagccgttacgc
tccgcgccgctcctaccctccgacactcctttcacaatatcgcctagcgattcagatgtg
gggctagatgaggaccttgatagttctaccaggagaccgcagaagcatacgttggacaat
attgcgccctaccgcaaatcgtctttgcatcttccgggtgcgggtgcggctgccagtgca
ccgccccacggccttcacccgtcgcctgtgattgatggtacgtctcgtccacaagaatta
atggtgacctccgacaagcgagccacaaatgccagtccggggggtagttctcatcagaaa
caaggacaatcgccgtgggattttgcgaagggacccaaagttgagagaagttctagtcgc
agtcgccgtgggagggtggagaactcgattgaagccgacatcaccaatgcagagcatgct
ccctatgttcgcagccgtaaatcgagtcattatctaggcctgtttaaagagaacaccgcc
acgtctccggatcgcaagcgaagagatgaccgttccgcaaggcatgataattcctctgag
tcgcggggcagggagcaacatggacctcatgcggagcatcgtcactctcgggacgaccaa
tatgaagcggacagtttcaagcgaccagaggttcagggttcgaaacgtttatcacagctt
tcgcttgctaatatcccaatgatcaagccgttcgcgggtggcgactctcaagaggattat
acagcggagcatgttcccgctaaatctgagcagaaaaggttgccgcggagccttcttgaa
gaaattcggaactttcaccttactcccggcggggcaagggggacgtctttctcgagaagt
atccctactcagtactcagaaagaagcaaagccttccatccacgctctcccttttcggat
acagaagaaccccatgtcggttcaggtcctctcgatgatgaggaagacgagcagatctct
tctgcagtgtattttccacacgagcgagtgacagtctccggtgaagtcgatcccctgcag
tctattgaagtgcatccacgtgacctgcattcatttgatgagtccgcgacggaggggagc
ctcgttctaaagccagagagacttactgctccggatgagcctgaaactaatcatgtggat
atatcccttcgatctaagaatgacagtagaattctgcacggcgatcttcaggacaggaag
actccaatagaagagctaaatgagaagtctattgattctatgttgcagcgccaaactgag
tactccactgaagaatccgaagccttctctgcagacgacagtggaacatccgttcgggat
gaagagtctagtgtgaccgatgaggctgaggtcacaccaacggctacccccacgcaacgc
ccacatatacctcggccccggcgaaagcaaggcgcagtaacaccagtcggagccgtggag
ttgaaaccataccggcatcaggtcggcggccatacaacggtctttcgattttccaggcgt
gctgtttgcaaacagctcaataatagagaaaatgagttttacgagcgcatagaacgcagg
catcccgaaatgttaatgtttctcccaaggtatatcggcgttctgaatgtgacattctcg
aagaagcgctccaagaaatcttcggaggctcagcttgaacaatcagacgttgatgctaca
gatgatccgcaaaataaaaatactgtcgcaaccaccggacacagtttgcacgaagctgcg
aattctgtggagaaagagcgcatttttagccagaaacaagtcactggtatagtacctaag
gtgatactcgaaaataaccgccatattattcctgttgatctgttctctcataaaagacct
cgcacagcgactgctgcgctgtctgacatgcgcccatcctccaacggggccgggcgcacc
actaaccagcgaaaccatgaacatggttcgttggatgaaaaactctcccactcgccagcg
aaaaagacttggggtgctaccactgtcaatcggaaactacaagaacaggttctcagagag
gtattcagcccacctgccatccaccaccataggcgccatgcccgaggactcctcaaccta
ccgagaacgacatctgatggccatcgtcggagcgccaacctttccgaaggtcttatcacc
cgtcaacctcgcattatggaacagatggaaccaccccgatctcctgccattgacattgta
aagaaaggcagcgacggtcctggcctctcgtcgtccgcttccacggctcttgagggtggt
cagcagcaccttgaatcggtaaggtcggaggaggccgtcccacgttctagctcggtgtcg
cgaactcgaagagtacgacgtcggcactccggcagtggcctgcagaggcggggaacaatg
gattcggacaagggcggcggcgaattaatctttttcgaggatgagggatacggtggtgac
aaggaggatgaaatattctcaatggaaagtgacgcgcctacgtcttctaccacacctggc
gaagcaaggctctctagctccagcccgtctaaagggagtgacctgattcctcaagatagg
tggacttctggtggtcctgtcgtcgaatcttcgaagagccccgcttttccaggtttcaac
gacaatatattatcgcagcctccagccaatccaaaggaagcgcaaacaaggaaagatgac
agggtgcagttcttccttctgctagaagatttgactgccgggatgaacaagccttgcgtc
ttggacctcaaaatgggcactcgtcaatacggtgtggaagcggacgacaaaaagcggaag
tcgcagagacgcaagtgtcagaacacgacctctcagcaacttggtgttcggctatgtggc
atgcagacctggaatgtgaagaagcaggaatacatatttgaggacaagtactttggtagg
gacttgaagtcgggtcgtgagttccaggatgccttaacacgatttctctacgacggcgtt
agttacttaagcgttgctaagaagatccctattatcctcgacaaactggcgaagctggag
aacatgatccggaaacttaagcggtaccgcctttatgccagtagcttgttgatcctttac
gacggcgaacagaatccccaacacaaagcctctcaacatgaagcggcttcaaacgacaat
gcgagaaatcatctgcaacgccgtacatctgaagatggacataataacaccgatgtttca
ttgaagatcgttgatttcgcgaattgtgttacaggtgaggatgaactttcgccaaatgcc
cgttgcccacctcaacacccagatgatattgatcgtggctacttgcgcgggcttcgtacc
ctgagaatgtatttccagcggatcatgaaagaggttagccaagatgaatatctcgagaga
ggcgaaggtgaaggcatagcgctcaacccccaatcatcgagcaataaccctacgtctgac
cgctactgggatgaaagcgtcatggatcaagacccaggagaggtcagcttctaa

DBGET integrated database retrieval system