KEGG   Aspergillus nidulans: AN6911.2
Entry
AN6911.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K20180  vacuolar protein sorting-associated protein 16
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN6911.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN6911.2
Membrane trafficking [BR:ani04131]
 Endosome - Lysosome transport
  Tethering complex
   CORVET complex
    AN6911.2
   Hops complex
    AN6911.2
SSDB
Motif
Pfam: Vps16_N Vps16_C
Other DBs
NCBI-GeneID: 2870626
NCBI-ProteinID: XP_664515
UniProt: Q5AXR9
Position
I
AA seq 774 aa
MAPSNPLANWERLGSSFYRKVPLYHSVFGEDVELENYIVAGAPYGGAIALYRDESKPLRF
RDAQTGKSNIDIYSRSGKLINRLNWEHGTIRGLGWSDQEELLVITEDGTVRRYFGLYGDF
TSFSLGNGAEEYGVRACRFWNSGFVALLANNQLIAVSSYNEPRPRLLAQCPEGEVASWSL
IPPAYTLSRSVEVLLAVDKTIYLVDPTEAEDKVLQNGPFKHASVSPTGQFVALLTAEGKV
WVVSSDFQSKYSEYDPDSRVTPRAVEWCGNDAVVIAWEDEVHLIGPNGAAARYWYDGTVH
VLPEFDGVGLLTNDTYEFLHKVSDVTETIFRLGSTSPASVLLDSIDLLEKKSPKADDNIQ
RIKPSLPEAVDMCVKASGLEFDAYWQKRLLKAASFGKSVLDLYNSDEFVEMTEKLRVLQA
VRDFQIGLAVSYDQYMRLTSEKLIERLVNRRNYLLAIRISEYLQLPADKIYVHWGSSKVK
VSTVDDEAVCKLIVQRLDGKPGISFEAIAQAAYDEGRSHLATQLLNHEPRAGKQVPLLLN
MEEDEIALDKALQSGDDDLVNYVLLHLKSKLPIASFFRMINTRPMASALVETTAREEDPE
LLKDLFYQDDRPLDGSNVLLSDALKESDLPRKQEKLLLASRLLSDSKDPTLVLHRNLLNE
SSQLLKTQEALDKDLAERSEFLGLSLNETVYRLIRSGYGRRAQKIQSDFKMPERTYWWLR
LRALVAKRDWGELEEIGKIKKSPIGWEELETQSWLPSSSQNAPIYPRRKELRCG
NT seq 2325 nt   +upstreamnt  +downstreamnt
atggcgccgtctaatcctctagctaactgggaaaggctcgggtctagcttctaccgaaaa
gtccctttataccactcggtattcggtgaggatgttgagctggagaattacattgttgcc
ggcgctccgtacggaggggctattgctctgtatcgagatgagagtaaacctctaaggttt
cgcgacgctcagaccggcaagtcgaacattgatatttactctcggtccgggaagttgatc
aaccggcttaattgggagcatgggacgataagggggctcggatggtctgatcaagaggaa
ctgctggtgatcacagaagacggtactgttcggcgctactttggtttgtacggtgacttc
acctcgttttctctcgggaacggagcagaggaatatggagttagggcgtgccgattctgg
aactccggctttgttgccttgctggctaataaccagctgattgctgtttccagctataac
gagccacgaccaaggctcctagcacaatgtccggaaggagaggttgcttcgtggtctctc
attccaccagcttatacgttatcccgctctgttgaggttcttcttgctgttgataagacg
atctacctcgtcgatcctacggaggctgaggataaagtgctccaaaatggaccttttaag
catgcgagcgtgtcgcccacgggccaatttgttgctcttttgacagctgaagggaaggtc
tgggtggtgagcagcgacttccaaagcaagtacagtgagtacgacccggactcgcgggtc
actccccgagctgtggaatggtgtggcaacgatgccgttgttattgcttgggaagatgag
gttcaccttatagggcctaatggtgcagctgcacggtattggtacgacgggactgttcac
gtgttgccggaatttgacggcgttggcctactcactaacgatacatacgagtttttgcac
aaagtatcagatgttactgagactatttttcgtcttgggtcaacatcgccggcgtcagtc
ctgttagactctatcgacctcctggagaagaagtctcccaaagcagatgataatatccaa
cggatcaaaccgagcctaccagaagctgttgatatgtgtgttaaggcatctggcttagaa
ttcgacgcttactggcagaagcgactgctgaaagcagcgtcctttggaaaatcagttctt
gacttgtacaacagcgacgaatttgtcgagatgaccgagaaattacgggttctgcaggcc
gtgagagacttccaaataggactcgctgtttcatatgaccagtatatgcgcctgacatcg
gagaagctaattgagcgtctcgtgaacagaaggaactatctacttgctatccggatatca
gaatacctccagctacctgctgacaaaatatacgtccactggggaagctcgaaggtcaag
gtttctacagtcgacgacgaagctgtctgcaagctcattgtgcaaagacttgacggaaag
ccagggatatccttcgaggccatcgcacaagcggcttacgatgaaggccgctcacacctc
gcaacccagcttctaaaccacgaaccgcgggccggtaagcaggttccgttgcttctgaat
atggaagaggatgagatcgcactggacaaagctctacagagcggagatgacgatcttgtt
aactacgttcttcttcatttgaagagcaaacttcctatcgcaagcttcttcaggatgatc
aatacacggccaatggcgtctgcacttgtggaaacaaccgctcgggaggaagatcccgag
ttgctaaaagatctgttttaccaggatgatcgacccttggacgggtcaaatgtgcttctt
tcggatgccctgaaagagagcgacttgccgcgcaaacaagaaaagcttctactcgcttct
cgactactttcggactctaaagacccgacattggtattacatcggaacctgttaaatgag
tcgtcacaattacttaaaacacaggaagctctggacaaagacctggcggaacgatctgaa
ttccttggcctgagcttgaatgagactgtctacaggctgatcagatcagggtacggtagg
cgagcacaaaagatccaaagcgactttaaaatgccagagaggacgtattggtggttgaga
ctacgagcgctagtagcgaagcgtgactggggagagctggaagagattggcaagatcaag
aagtcaccaataggatgggaggagctggaaacacaaagctggcttccgtcttcgtcccaa
aatgcaccaatctacccgcggaggaaagaattgagatgtgggtga

DBGET integrated database retrieval system