KEGG   Aspergillus nidulans: AN7428.2
Entry
AN7428.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K08337  ubiquitin-like modifier-activating enzyme ATG7
Organism
ani  Aspergillus nidulans
Pathway
ani04136  Autophagy - other
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN7428.2
   04136 Autophagy - other
    AN7428.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN7428.2
   04121 Ubiquitin system [BR:ani04121]
    AN7428.2
   03029 Mitochondrial biogenesis [BR:ani03029]
    AN7428.2
Membrane trafficking [BR:ani04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    AN7428.2
   Atg8 conjugation proteins
    AN7428.2
Ubiquitin system [BR:ani04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   AN7428.2
Mitochondrial biogenesis [BR:ani03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AN7428.2
SSDB
Motif
Pfam: ATG7_N ThiF Shikimate_DH 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 2869542
NCBI-ProteinID: XP_680697
UniProt: Q5AWA2
Position
IV
AA seq 617 aa
MQYTPFASDIELPFYIALASLKINHDKLDDSARKVLGLYELRPSDAPNASCRIQIHGNAL
TSDEVPSTYYRAEGMIKNVNTIEEYAKADKMGMLQQSGETIWNAINNGTIYSCPSLLSAF
VILSYADLKKYKFHYWFAFPALHSDPSWTPLEEGCEGAQAHRLPSVESSALARSVQEWAR
VVDAPQRGFFLARRVRMRDDDTVSWKIASLSSYEDGFFKHAEFADCFTCFVDPSNYEEAP
GWMLRNLLVLVKRRWGLTKVQILRYRDGPSPRDCGRSIVVTLRLKTSQLPDGGVKDDRMP
KVTGWERNPSADQSVDLNLKLMKWRISPNLDLEKIKGTKCLLLGAGTLGSYVARNLMAWG
VRKITFVDNGSVSFSNPVRQPLFNFADCLDGGAKKAYRASQALSEIYPGVESVGHVLAVP
MAGHPVLDAEKTKADFEVLKGLIDAHDVIILLMDTRESRWLPTVMGKAAGKIVMNAALGF
DTFVVMRHGVTNNEHPEEELGCYFCNDVVAPMNSQKDQTLDQQCTVTRPGVAAIASALLV
ELLVSLLQHPLGAAAGAPQTPNNTQNDHPLGVIPHQIRGFLSTFENVSVVQEMAEANLAD
IEWDEDLEPEEITPVMD
NT seq 1854 nt   +upstreamnt  +downstreamnt
atgcagtacactccatttgcctcagatatagagctgccgttctatattgccctggcttct
ctcaagataaatcatgacaagctcgatgattccgcgcgcaaagttctgggcctgtacgag
ttacgcccgtcagacgctcccaacgcctcgtgcaggattcaaatacatgggaatgccctc
actagcgacgaagttccgtctacttattaccgagcggaaggcatgataaaaaatgttaat
actattgaggagtacgcgaaggccgataaaatgggcatgctccaacagtctggagaaacg
atatggaatgctatcaacaacggcactatctactcatgtccatctctgctgtccgccttc
gtcatcctctcttacgctgacctcaaaaaatacaagttccattactggttcgcattccct
gcacttcactcagacccgtcttggaccccactggaggagggatgcgagggagcgcaagca
catcgacttcccagtgtagagagttctgcactcgcccgttcggtacaagagtgggctcgc
gttgtagatgcgccgcaacgaggttttttcctagcacgaagggtaaggatgcgggatgat
gatactgtctcctggaaaatcgcatccctgtcaagctacgaggacgggtttttcaaacac
gcggaatttgcggattgctttacctgttttgtcgatccctcaaactatgaagaggcccct
ggctggatgctccgaaatctgctcgttctcgtgaagcgaagatggggacttacaaaggtt
cagatattacgctaccgggatggaccatccccgcgtgactgcgggcggagtattgtggtg
actctacgactgaagacatcacagcttcccgatgggggggttaaggatgaccgtatgcct
aaggtgacgggatgggagcgtaacccgtctgctgaccagtctgttgacctcaacctcaaa
ctcatgaaatggcggatcagcccgaatcttgatctcgagaaaatcaaaggcacgaaatgc
cttctacttggagctggaacccttggaagttacgttgctcgaaatttgatggcttggggg
gtaaggaagataacattcgtagataatgggtccgtgtctttttcaaacccggtgaggcag
cctctcttcaactttgcggactgtctagacggcggcgcgaagaaagcctaccgagcgtcc
caggctctgtcggagatctacccaggcgtggaatccgtcggccatgtactagccgtccct
atggcaggtcaccctgtattggacgcggaaaaaacaaaggcggatttcgaggtcctaaaa
gggcttatagatgctcatgacgttatcattcttttgatggatacgcgcgaatcacgttgg
ctaccaactgtgatgggtaaagcggcaggtaaaatcgttatgaatgcagcattgggattc
gacaccttcgttgtaatgcgccatggcgtcacaaacaacgaacaccctgaggaggagctt
gggtgttatttttgcaacgatgttgtggcccccatgaattcccagaaagaccagacgctc
gaccagcagtgcactgtcactcgacctggagtagctgccattgcatcggctttattggtc
gaattgctagtctcgcttcttcagcacccgcttggggctgccgcaggtgccccccaaacc
ccgaataacactcaaaatgatcatcctctcggggtcatcccgcatcaaatcagagggttc
ctatccacatttgaaaacgtctctgtggttcaagaaatggcagaagcgaacctggctgac
attgaatgggacgaggatttggaacctgaagagataacgccggtcatggattaa

DBGET integrated database retrieval system