KEGG   Aspergillus nidulans: AN7437.2
Entry
AN7437.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K06902  MFS transporter, UMF1 family
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN7437.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN7437.2
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ani02000]
    AN7437.2
Membrane trafficking [BR:ani04131]
 Autophagy
  Other autophagy associated proteins
   Others
    AN7437.2
Transporters [BR:ani02000]
 Major facilitator superfamily (MFS)
  Unknown transporters
   Unknown major facilitator-1 (UMF1) [TC:2.A.1.24]
    AN7437.2
SSDB
Motif
Pfam: ATG22 MFS_1
Other DBs
NCBI-GeneID: 2869459
NCBI-ProteinID: XP_680706
UniProt: Q5AW93
Position
IV
AA seq 580 aa
MQEDGIAEPGLLLPRYPGDDTRPTNKKELLGWYSYGWAAEVFTVCAMEQMARERGVLLSD
KTTPCTAIWKTPESSNTSWQNSSPAAAGQCIVYILGAEINTASFAMYTFSVSVLIQAILI
ISMSGAADHGSYRKTLLVSFAAIGSICTMLILAVTPKVYLLGGLFAIVANTCLGASFVLL
NSFLPLLVRYHPSLLKEESGYMVRSPTENSGQPIATDCFSNDDPRAALLQGDGMTPEDTR
EFISSSNTSKELTISTRISSYGIGIGYIGAVFLQGICILVIVQTRQTTFSLRLVLFLIGL
WWFIFTIPAAFWLRPRPGPPLLRAQDGKAYQSWLGYMAYAWKSLGRTAMRTRHLKDILLF
LASWFLLSDGIATVSGTAVLFAKTQLNMEPAALGMINVITMISGVFGAFSWSYVSRVLNL
RASQTIIACIFLFELVPLYGLLGFIPAIKNLGFLGLQQPWEMFPLGVIYGLVMGGLSSYC
RSFFGQLIPPGYEASFYSLYAITDKGSSVFGPAIVGFITDHYGEIRPAFFFLAILILLPL
PLMLLVDADRGKRDALALAEVLEARSSLEQRDYGTFSQQQ
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgcaggaagatggaattgctgagcctgggcttcttctcccacgatacccaggcgatgac
acccggccaacaaacaagaaagagctgctggggtggtatagttatggttgggcagcagag
gttttcacagtatgtgctatggagcagatggcccgagaacgtggggttctactctcggac
aaaacgacaccgtgtactgcgatctggaaaactccagagtcatcaaacacaagctggcaa
aattcaagtcccgccgctgcaggtcaatgtattgtttacatccttggggccgaaatcaac
accgcaagcttcgcaatgtacaccttctccgtgagtgtcctcatacaagcaatcctgata
atatcaatgtcaggcgctgcagatcatggaagctaccgcaagacgctcttagtatcattt
gcggctattggctccatttgtacgatgttaatccttgcggttactccgaaagtataccta
cttggtgggttattcgctattgttgctaacacctgcctcggggcatcgttcgtgttattg
aactctttcctacctttattggtccgatatcatccttcgttacttaaggaagagagtgga
tacatggtccgttctcctactgaaaacagtggtcaaccaattgccacggactgtttttcg
aacgatgaccccagagcagcacttctacagggagatggaatgactccagaagatacaagg
gagtttatatcgtcatcaaacacgtcaaaagagctgacaatatccactcggatttcgtca
tatgggattggcattggctacatcggtgctgttttcctacaaggtatatgcatccttgtc
attgtccagacccgccagactaccttttcgctacgcctcgttcttttcttgataggttta
tggtggtttatcttcactatacctgcggcattttggctcaggccgcgccctgggcccccg
ttgctgcgtgctcaagacgggaaggcctatcagtcatggctcggctacatggcgtacgct
tggaagtcgctcggccgaacggcgatgcggacgcgacatttgaaggatattctgttattc
cttgcatcctggttcctgttgagcgatggaatcgccaccgtcagtggtacagccgttctc
ttcgctaaaacccagttgaatatggagcccgcagcgttggggatgatcaatgtgattaca
atgatctcaggagtttttggtgccttttcttggagctacgtttcacgagtgctgaacctt
cgcgcttcgcagaccatcatcgcttgcattttcctttttgagcttgtgccgctttatggt
ctgttgggctttattccagccatcaaaaacctcggcttcttgggtcttcaacagccgtgg
gaaatgttcccattaggggttatatatgggcttgtcatgggagggctttcgtcgtattgt
cgaagtttcttcgggcagctgatccctcctggatatgaagcgtctttctattctctttac
gctataacggacaaaggctcgagtgtatttggaccggcaattgttggatttatcacagat
cattatggggagattcgtcctgcgttcttctttctcgcgatacttattcttctacctttg
ccgttaatgctcctcgtggacgccgatcgaggaaagcgagatgcgctggcattggcagaa
gtgctggaggcacgttcgagccttgaacagcgtgattacggaacgttttcgcaacaacag
taa

KEGG   Aspergillus nidulans: AN7591.2
Entry
AN7591.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K06902  MFS transporter, UMF1 family
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN7591.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN7591.2
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ani02000]
    AN7591.2
Membrane trafficking [BR:ani04131]
 Autophagy
  Other autophagy associated proteins
   Others
    AN7591.2
Transporters [BR:ani02000]
 Major facilitator superfamily (MFS)
  Unknown transporters
   Unknown major facilitator-1 (UMF1) [TC:2.A.1.24]
    AN7591.2
SSDB
Motif
Pfam: ATG22 MFS_1 TMEM252
Other DBs
NCBI-GeneID: 2869421
NCBI-ProteinID: XP_680860
UniProt: Q5AVT9
Position
IV
AA seq 593 aa
MASFSQLASSPEEPDFERRFLRYRGEDTSPTGRREIWGWYAYGVAAEVFAVCGVGSFLPL
TLEQLAREQGFLSSSHLPCVGPDAPPAAGNGTAPANEACVVPLMGLEINTASFAMYTFSL
AVLIQALTLVSFSALADYENNRKALLLAFGFIGSATSMLFMLIVPPVFVLGALLVVIGVT
CLGSSFVVLNSFLPILVANDPSVQRASNKNKDDLHDLHTEGDEFSLRSWTDEEDTGDHAG
PAGSKKAVEPEKASSSTSPELQLSTRISSRGVGLGYCAAVLVQILSILLLFTLSKTSMGK
SHPTLPLRFVLLLVGIWWAAFTVVCSRWLRSRPGPPLEGVTPGAGYRQKWRVWLRVVGFA
WKSLWNTIKVALRLREVVVFLAAWFLISDAIATVSGTAILFARTELHLSTVSVGLLSITA
TMSGMAGAFLWPIVARRFALASNHTILLCIALFEIIPLYGMLAYIPFIRNWGVLGLQKPW
EIFPLGIVHGVVSGGLASYCRSLFGELIPPGSEAAFYALYAATDKGSSFVGPAIVGALID
ATGSVRSGFIFIGVLILLPMPLVWLVNAERGRQDAIAMVKHAPNSEEGEGLLR
NT seq 1782 nt   +upstreamnt  +downstreamnt
atggcgtcgttctcccagctcgcctcctctcccgaagagccggactttgagcgtcgattc
ctgcggtaccgcggggaggatacctcccccacaggccgtcgcgagatttggggatggtat
gcctacggagtcgctgccgaggtgtttgccgtatgcggtgtcggctcgttcctccccctc
accctagagcaactggcccgcgagcaggggttcttgtcttccagtcatctgccatgtgtc
ggtccagatgcgcctcccgctgccggtaacggaaccgcgccggccaacgaggcctgtgtt
gtcccgttgatgggcttggagatcaacacggcgagttttgctatgtacaccttctcgctt
gccgtgctcatccaggccttgaccctcgtgtcctttagtgctcttgcggattatgaaaat
aaccgaaaggccctattactggcattcggctttatcggatccgcaacgtccatgctcttc
atgctcatcgttccgccagtcttcgtactcggagcgctcctggttgtgatcggggtcacc
tgcctcggctcctcttttgttgtcctgaactcattcctgcctatcctcgtcgcaaatgat
ccctcggtacaaagagcctcgaacaagaataaggacgaccttcatgacctccatacggaa
ggagacgaattctcgctgcggtcttggacggacgaagaagataccggtgatcatgccggc
ccggcgggctcaaagaaggctgttgagcccgaaaaggcgtccagctctacgtcgcccgaa
ctgcagctctctactcgcatctcgtcacggggtgtgggcttgggttactgtgcagctgtc
cttgtgcagattctaagcatattgttgctgttcacgctgtcgaagacgtccatgggcaaa
tcccacccaactctgccgctgcggtttgttttgcttctagtaggtatatggtgggctgcc
ttcactgtcgtctgcagccggtggttacgaagccgtcctggccctccgttagagggtgtc
acccctggcgctgggtatcgtcagaaatggcgtgtctggctacgcgttgttggttttgcg
tggaagtctctctggaataccattaaggttgcactgcgattgcgtgaagttgtggtattc
ttggccgcgtggtttctgatttccgacgccatagcgacagtgtctggaactgcgattctt
tttgcgcggacagaactgcatctgagtaccgtctctgttggtctcttgtctatcacggcg
acaatgtctggaatggcgggcgcgttcctgtggccgatcgtagcccgtcggtttgcgctg
gcgtccaaccatactattcttttatgcatagcactgtttgagatcatccccttgtacggg
atgctggcttacatcccctttattcgaaactggggtgtgttggggctacagaagccatgg
gagattttccctttgggcattgttcatggggttgtctctggaggattggcatcgtactgt
cgctctttgttcggcgagcttatcccgccaggcagcgaggctgcgttttacgcgctctac
gcggccaccgacaaaggaagctcattcgtgggtccggctatagtcggcgccctgatcgat
gcgaccgggtctgtccggtccggattcattttcattggcgtcttgatcctactaccgatg
ccgctagtgtggttggtgaatgcagagcgagggcgccaggatgcaatagccatggtgaaa
catgcgcctaatagtgaagagggggaggggctgctgcgctaa

DBGET integrated database retrieval system