KEGG   Aspergillus nidulans: AN7572.2
Entry
AN7572.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K12767  serine/threonine-protein kinase RIM15 [EC:2.7.11.1]
Organism
ani  Aspergillus nidulans
Pathway
ani04113  Meiosis - yeast
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN7572.2
  09143 Cell growth and death
   04113 Meiosis - yeast
    AN7572.2
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ani01001]
    AN7572.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AN7572.2
Protein kinases [BR:ani01001]
 Serine/threonine kinases: AGC group
  MAST family [OT]
   AN7572.2
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Response_reg Kinase-like ABC1 APH Kdo Haspin_kinase Seadorna_VP7 Folliculin
Other DBs
NCBI-GeneID: 2869551
NCBI-ProteinID: XP_680841
UniProt: A0A1U8QRM6 Q5AVV8
Position
IV
AA seq 2104 aa
MAGNDAENVQYLTPPAVNALRQEARSVDPKNLPTRTLSSDTMREERENLREAAEQTLNVI
VDLDLEGRVKWVSPSWKQVVGTDLDTIERRLISDVLVDNKSAFLDAIESLKEDDSRSRFI
RVSVQLGPDSVFKYAPAPRPLKREQTDGADSAAEEPSFEMEEDGPAILNLEGQGIMVYDR
TAEGVAHTMWMLRPYSKPREVTIDLPSSLVESLGVGAEVLANYLTVLAEAAANEPDQSKH
PAPEPVLCRICERQITPWWFEKHSDLCLQEHQAEMDVQIAQENLNEHRHAIVRVLDALEA
RQGRPISSRDGSSPHLPQPEYKGLPIGPSPVASAPSSGSTSTTSSAPATPPRSRDQSVSG
SGHIRARSFAVRRPLARVVELILDLCDTALEINMPVLRESRGDNGDEFRTMSPQSESRIS
QVLQWHSPSSNTLEQEQGLAALCTDTEQVARSKVDAVIRHRRIVEYAERIRIEYTVLVEE
CITAALRKAERIAAGQLSDSSSSEDETPSDETTSDPSASSASILVQNAGHEPELPPPVSA
LTMSMRNATDRFQSGHSSEGKSSSAAVSTGPSSPMECPTPRSHKSVANLLGTSQPSRRGL
SLADIDSGDQSDSSIVSSSITGAMRTDSPSSDRSLERKRRSLVLPGLSSSPRRQHSPARV
SGPHSPLRMPKPRLSTGAESLSSPIVSPSSNLGELALHHYRHHRRQSSTTSSDLPRPPVS
PHLTTASQPQPRPSPPSIKDFEIIKPISKGAFGSVYLSKKKTTGEYYAIKVLKKADMVAK
NQVTNVKAERAIMMWQGESDFVAKLYWTFSSKDYLYLVMEYLNGGDCASLVKILGGLPED
WTKKYIAEVVLGVEHLHSRGIVHRDLKPDNLLIDQKGHLKLTDFGLSRMGLVGRQKRVLK
SMNEQSGDILKQGSFPRATSIASSRSASFDFQGSGSPGSTPLITPDVAGSMPQPSYFNLN
QSGLSRQPSRRASGYRSDSGGSENLNAIFRTLSLNEGETPGAMPIPPPPPSDSAHEEEGQ
SEPAESPYLQPLQPTHSNVSTGTPPQQTMMPPLMALFDPEDHNRRFVGTPDYLAPETING
VGQDEMSDWWSLGCIMFEFLFGYPPFNAATPDEVFENILHRRINWPGEVEELASPEAIDL
MNKLMAINPRERIGANLEEKYPNGGAEIRSHPWFADIHWDTLLEDKAQFVPNLENPEDTE
YFDARGATLQAFTEEDESSPQAPVTTGSYIDRPHDALYKVRSQVNSIKRPLMPLHIPPHV
REPRSRRLSEPSLADDFGNFAFKNLPMLEKANKDVIQKLRQEALQAQQRQSSNAGTQQQP
QTQGQTQATGPTPPSGPSLDGSPLPMSLQRTLSQSKGNNRPASPSSLSQANSSPSRPSQP
SSPLLVQFSTGHNHERRKTSGSSSTTASHQSSGSFQPASADQTRVANSNKFGSASSSPIK
PNRVGTHSPDKSGPGPHRHGSAPSTRTRSQTIGSQDGELSSSLARETYVPGHHKRRSQLF
DVSPSSSDNEDPRAKALLKVQRRRQSSRRLSQINFADGPFFRPLDILICEDHPISRLVME
RLFEKLRCRTITVANGAEAVRYALSEVQFDIIMTEFKLPQVNGADVARMVRETRSANRHT
PIIAVTSYLKDLPETHHFDSLIEKPPTLTKLTEVLCKFCQWKPPPKDYNPSMFAARQTPP
TQSDHSPSSTVSSGFALVPSSSYRGSSREESVGSSYFGDLDSIKAEEVPVIVSRQTDDWS
QGTGGLGISEDSTSGQGSADSNRGAQNSTVPFPGLPHAAHSPPALSPSGMITPRKQRSSE
AIRAKRESLERKRYECAESGDDEDEELGNLPSRTQSPRNRASRPGSKLGIEMMRTNSRGS
VISTSEDALKKDKEAGERSRSGGSDDADEHARDKIRSGRSSLESKFEDLNIPEEAILPSI
EDDLSPRNSPSPLALASRSALLTSDTKPPCSRYITKIHKRADSTASLESPKRGQITPPVV
FPSQSQNPSEAYPSTPPIVFDGPADSGPYQSSLTPIPDSDATPRPMHTPCPNPDTEKTPR
PGRLSTWHWFQSRKKPDQNLLQDCCIYMLASPMQCILTGTIYTVADAGKERCFPRLSARV
RARE
NT seq 6315 nt   +upstreamnt  +downstreamnt
atggcgggcaatgacgcggaaaatgttcagtaccttactccaccggccgtgaatgcctta
cggcaggaggcccggagtgtcgatccgaagaatctccctacgcgtactttgagcagtgat
acaatgcgtgaagaacgggagaacctgagggaagcagcggagcagaccctaaatgtcatc
gtcgacctggatttggaaggccgtgttaaatgggttagtccgtcctggaagcaggtcgtg
ggtacagatctggatacgatagagcggcggttgatctcggacgttctggtggacaacaaa
agtgcttttctcgacgcgatagaatctctgaaggaggatgactcccgcagccggttcatc
cgtgtatctgtgcagcttggtcctgattcagtgtttaagtacgcacctgcaccacggcct
ctaaagcgggagcaaacggatggagcggatagtgcggcggaggagccttcgttcgagatg
gaggaggatggcccagctattctgaacctcgaagggcagggtattatggtttatgaccgt
acagccgaaggggtcgctcacactatgtggatgttgcggccatattcaaaaccacgagaa
gttactatcgacttgccatcatccttggtagagtctttgggcgttggagctgaagttcta
gcaaactacctgacggttctagcggaggcggctgcaaatgaaccagatcaatccaaacac
cctgcacccgaacctgtcttatgtcgcatttgtgagcgtcaaataactccttggtggttc
gagaagcactcggatctttgcctgcaagaacatcaagcagagatggacgttcagatcgcc
caagagaacctcaatgagcaccggcatgctatcgtgagagtgctagacgcgttagaggca
aggcagggtagaccaataagttctcgcgatggtagctcccctcatttgcctcaaccagaa
tataaaggtctgcccatcggaccctcgcccgtcgcttcggcgccctcctcaggatctacg
tctacgactagctccgctcccgcaactcctcctaggtccagagaccagtcagtctccggg
tctggtcatatacgtgcccgttcttttgcagttcgacgaccgctagctcgagttgttgag
ttgatactcgatctctgcgatacagctctagaaatcaacatgccagttcttagagagtcg
cgaggcgacaacggcgacgaattccgaaccatgtcaccacaatcggagtctcgtatttct
caggtgcttcaatggcattcaccaagctctaatactttggaacaggaacaaggtcttgct
gcgctgtgtacggacacagagcaagtcgcgagatcaaaggttgatgcggttatccgtcat
cgccgaattgttgaatacgcggaaaggattcgcattgagtataccgtgctggtggaagaa
tgcattactgcggcactgagaaaggccgagcgtatcgctgccgggcagctgagtgattct
agctcctctgaagatgagacgccatcagatgagacaacctccgacccatctgcctcctca
gcgtctatattggtgcaaaatgctggtcatgagcctgagctacctccgccagtgtctgct
ttgacgatgtcgatgcgtaatgcaacggatcgcttccagtcgggtcattcctctgagggg
aaatcttcatctgctgctgtttcaactggtccatctagtcctatggaatgtcccactcct
cgctcacacaagagtgtcgcgaacctgctggggacttctcagccgtcgcggcgtggtttg
tctttggctgatatcgattcaggcgatcaaagtgatagcagcattgtctcgtcttctata
actggggctatgcggactgactccccgtcatcggatcggagtctggagcgtaagcgcaga
agcctggtgcttccgggcctgtccagctcgccacggcgacaacattcgccagctagagtg
tctggacctcattcgccgctgcgtatgcctaagccgcgtctttccactggggctgagagt
ttatcatccccaatcgtatcgccctcatccaatctaggcgagttggctcttcatcattat
cgacatcaccgccgtcaatcgtcaacgacatcctctgatttgcccaggccgcctgtttca
cctcatttaacgactgcaagccaaccccaaccacgcccgtcacctccatccatcaaagac
tttgaaatcatcaagcccataagtaagggtgcatttggcagtgtttatctgtccaagaag
aagacgactggggagtactatgcgattaaagtgctcaaaaaggctgatatggttgccaag
aaccaggtcaccaatgttaaagccgagcgagcgatcatgatgtggcaaggggaaagtgac
ttcgttgcgaagctttactggacgttctccagtaaagactacctttacctggtcatggag
tatctcaatggaggcgactgtgcttcacttgttaagatcctcggtggcttgcctgaggat
tggacaaaaaagtatattgccgaagttgtcctaggcgttgagcatctccacagtcgaggc
attgtgcatcgcgacctcaaacctgacaacctactcattgaccaaaagggtcatctgaag
ttgacagattttggtctgtctcgtatggggttagttggtcgtcaaaagcgcgttctgaag
agcatgaacgaacaatcaggagacatcctaaagcaaggatcatttcctcgagccacctca
atagcttcgtctcgatctgcttcgttcgactttcagggaagtggctcaccagggtccact
ccgttgatcacgccagatgtagcaggcagcatgcctcagccgtcctactttaatttgaac
cagagtgggcttagtcgacaaccatcgcgtcgagcatctgggtatcgcagtgacagtgga
ggtagcgaaaatttgaatgcgattttccgaacgttgtcactgaacgaaggtgaaacgcct
ggtgccatgcctattcctcctccccccccttctgacagcgcacacgaggaagagggtcag
agcgagccagccgaatccccttacttacaaccacttcagccgacacacagcaatgtgtca
acgggtacccctcctcagcaaaccatgatgccgcctttaatggcactgtttgaccccgag
gatcacaacagacgcttcgtgggtacaccggattatctggcaccagagacaatcaacggt
gttggtcaggacgaaatgagtgattggtggtctttggggtgtatcatgttcgaatttctt
ttcggctatcctcctttcaatgcggccaccccggacgaagttttcgagaacatacttcat
cgaagaatcaactggcccggcgaagttgaggaactggcatcacctgaagccattgacctc
atgaacaagctcatggctattaacccccgggagcggataggcgcgaacctggaagagaaa
tatcccaatggtggagcagaaattcggagtcatccttggtttgctgacatccattgggat
accctcttagaagataaggctcaattcgtccccaacctggaaaaccccgaagatacggaa
tactttgatgcccggggtgccacactccaggcttttactgaagaagacgagagttctcct
caggctccggttacaactggctcatatattgaccgaccgcatgacgctctttataaagtt
cgctcacaagttaactcaattaagcggccattgatgcccctgcatattcctccccatgtt
cgggaaccccgaagcagaagattaagcgagccctcattggcagatgattttggaaacttc
gcgttcaagaatcttccgatgttggagaaggctaacaaagatgtgattcagaaactacga
caggaggcgttgcaagcacaacaacgccagtcaagcaatgcaggaactcagcagcaaccg
caaacacagggccaaacccaggcaaccggtccaactccaccctctggaccgtcgcttgat
ggaagcccattgccaatgtctctccaacggaccttgtcccagtcgaaaggcaacaacaga
cctgcgtctccatcttcccttagtcaggccaactcctcaccaagtcgaccctcgcagcct
tcatctcctcttcttgttcagtttagcaccggtcataaccatgagcgcagaaagacctca
ggatcgtcctcaacaacagcttcacaccagtcgagcggatcgttccagcctgcttctgct
gatcaaactcgcgtggcaaacagcaataaatttggctctgcctcatcgtcgcccatcaaa
cccaaccgggttggaacacattctcctgataaatcaggtccaggtccacaccgtcatggg
agtgctccgtcaacaaggacacggtcacaaactattggttcacaggatggcgagctctct
tcatccctagccagagaaacctacgtccctggtcaccacaaacgccgaagccaattgttt
gacgtctcgccttcttcatcagacaatgaggatcctcgagcgaaagctttactaaaagtg
caacgacgccgccagagctcaaggcgactttcgcagatcaattttgctgatggtccgttc
ttcaggcccttggacatcctcatttgtgaggatcatccaatctcgcgcttagtcatggag
cgtctttttgagaaacttcgttgccgcactatcacagttgccaatggggcagaagcagta
cgctatgcgctcagcgaggttcaattcgatatcatcatgacagagtttaagctcccgcaa
gttaacggggccgacgtagcgcggatggtcagagaaacccgtagtgccaatcgacatacg
ccaatcatcgcggttaccagttatctcaaagatctcccagaaacacatcacttcgactca
ctgatcgaaaagccaccgaccctgacaaagctgacggaggttctctgcaaattctgtcag
tggaagccgcctccaaaagactacaatccatcaatgtttgctgctcgccaaacgccccct
acccaatccgaccatagtccaagctcaacagtgtcatctgggttcgcactggtaccatca
agctcataccgggggtctagtcgtgaagaatctgtcggcagcagttattttggggatctg
gattccatcaaagctgaggaagttcccgtcattgtaagccggcaaacggacgactggtcc
cagggcacgggaggtttgggtatatctgaggactcaacttccggacaaggtagcgcagac
tcaaatcgcggagcccagaactcaacggttcccttccccggcttgcctcacgctgctcac
agtccaccagcattgagtccttcgggtatgatcactccgcgaaaacagcgctctagtgaa
gccattcgagcaaagagagaatcgctcgagcgcaaacgctacgagtgtgcggagtctggc
gatgatgaagatgaggagctcggaaatctgccgtccaggacgcaaagtccaaggaatcgc
gcgagtcgaccaggctctaagctgggtattgagatgatgagaaccaatagcaggggcagc
gtcattagcacaagcgaagatgctcttaagaaagacaaagaggccggagaaaggagcagg
agcggtggttccgatgacgctgatgaacatgcacgcgataaaattaggtccggtcggagc
tccttggaaagcaaatttgaagatctcaacatccccgaagaggctattttaccatctatc
gaagacgatttaagccccaggaactcgccttcacctctcgccctggcctcaaggtctgcg
ctgttaacctctgacaccaagccaccatgctctcggtatatcacgaaaattcacaaacgg
gcagacagtactgcaagtcttgaatcccctaagcgaggacagataactccccccgtcgtc
tttcccagtcagtctcagaatcccagcgaggcgtacccgagtactcccccgatcgtgttc
gacggcccggccgactcggggccataccaatcaagtctcactcccatcccagattctgac
gccacgcctcggcccatgcatacaccttgccccaaccctgatacagagaaaactcctcga
ccagggaggttatcaacttggcactggttccaaagcaggaagaaaccagaccaaaacttg
cttcaagactgttgtatctatatgttagcatcccccatgcaatgcatccttactggaacc
atttataccgttgctgatgcgggaaaagagagatgctttcctcgcctttcggccagagtc
cgtgctagggaatag

DBGET integrated database retrieval system