KEGG   Aspergillus nidulans: AN8488.2
Entry
AN8488.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K08516  synaptobrevin homolog YKT6
Organism
ani  Aspergillus nidulans
Pathway
ani04130  SNARE interactions in vesicular transport
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    AN8488.2
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN8488.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN8488.2
Membrane trafficking [BR:ani04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   Ykt6
    AN8488.2
SSDB
Motif
Pfam: Synaptobrevin Longin
Other DBs
NCBI-GeneID: 2868603
NCBI-ProteinID: XP_681757
UniProt: Q5AT92 A0A1U8QH44
AA seq 197 aa
MKIVYIGVLRNAQPDPIELCCERELSSYSRFTRGSIAEFTTMFSKLLTGRTSPGQRQDVQ
EKDFTFHVYASSASPGITGVIISDDEYPSMAAHQILSKLLDEFTTQNPSATSATGPVSFP
ALTSYITKYQDPQNVGSILKIQKELDETKVVLHKTIESVLQRGEKLDDLVQKSEGLSSQS
KMFYTSAKKQNSCCIIM
NT seq 594 nt   +upstreamnt  +downstreamnt
atgaagatcgtttacattggtgtcctccgcaacgcgcaacccgatccgatcgagctatgt
tgcgagcgggagctgagcagctactcccgcttcactcggggaagcatcgcggagttcacg
accatgttcagtaagcttctcaccgggcgaacaagccccggccaacggcaggacgtccaa
gaaaaggatttcaccttccacgtctacgcctccagcgcatcacccggcatcacaggcgtg
attatcagcgatgacgaatacccctcgatggctgcgcaccagattctctccaagctcctc
gatgagttcacgacccagaacccctccgctacaagcgccaccggccccgtctcctttccc
gccctcacctcctacatcaccaagtatcaggacccgcagaatgttggcagtatcctgaag
atccagaaggagcttgatgagacgaaggtggttttacataagactattgagagtgttctg
caacgtggtgagaaactcgacgaccttgtgcagaagagcgagggtctcagctcgcagagc
aagatgttttacactagcgcgaagaagcaaaactcctgctgcattatcatgtga

DBGET integrated database retrieval system