KEGG   Aspergillus nidulans: AN9500.2
Entry
AN9500.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K21197  PHO85 cyclin-5
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN9500.2
SSDB
Motif
Pfam: Cyclin Cyclin_N
Other DBs
NCBI-GeneID: 3684099
NCBI-ProteinID: XP_868882
UniProt: Q5AQD0
AA seq 785 aa
MYPAVSSVVPVTSIAESITPDIKGFSDMVIGTLDGDSSSTPCHVLLPRLILTYPNSPLPR
WVTLHLTPQPSDLDTLNTNWSTIVLKARRRLRNQDGILSYRFSFTVTCTTFKASYAHPYA
SSISSSASSSSSSVFSLDAVSTQSSISSSSTSSVDVIWENEGEYQAGGRLGTTGGVRGCL
RGNAPTAADVAVPPELRKHPRRTNSGLQPSGVSGARPPPCLLRQSERKVNFVDNLVDTAS
MIVETIWPLSAVSLRSDSATGCKGVLPLRTFIQETLRRSRTSYSTLQVALYYLIKIKAHV
PSSEQTQDQSRSRPVCRAMQCGRRMFLAALILASKYLQDRNYSARAWSKISGLNTAEINQ
NELLFLEAVDWKLHITEATFQRWTDIVLKYTPGAGNMFPVNGQSWRTVIPRLTPELDEID
SEPMTPTSVGGYDSSFASNSPSPRSTCARPPIYPSVNVEPTALPSISQISEPSRPDSTIP
PLPSLPRLPLLPTPQLTPQTSNASTPAVSAGCRPSYRRQMCAAMSQSMCTARSMYDQRPS
LCSKASSALEGFPTFMRRSSLARSTSSASSPESMVSDVSTLSSQSSRSSFSSASGTSAPT
LPSLAMQATLRCTGNSFKGTRKHMPMASPIDEITFSGSNSPEGYLGSTSRAPDMSSFSME
TPVDVTSAREAAQSLCQLSGQKSTGQGQRRQCRKRGRTGSDDLLLQQHVRSLIRSDTLAE
GTVLPDGNMAELLRMSQPDNTSPSLPSLSALGLGAPLSGPAGMKRACCGSEARKIALHPS
LRVDY
NT seq 2358 nt   +upstreamnt  +downstreamnt
atgtaccctgctgtttcgtctgttgttccggtcacctctatcgcagaatccattacccca
gatatcaaaggcttttccgacatggtgatcggaacactagacggtgactcctcttccact
ccttgtcacgttctcctacctcgacttatacttacctaccctaactcgccactacctcgt
tgggtgactcttcatctaacgccccaaccttctgaccttgatactcttaatacaaactgg
agtaccattgttcttaaggctcgccgtcgcctgcgaaatcaagacggtatcttgtcttat
cgcttctcgtttacggttacttgcacaacgtttaaggcatcctatgcgcatccgtatgcc
tcgtcgatctcatcgtcggcttcctcctcttcctcctcggttttctctctagatgcggtg
tccacccaaagctccatctcttcatcgtccacaagttccgttgatgtgatctgggagaat
gaaggtgaataccaggccggaggaagacttggtaccaccggcggtgtgcgtggttgttta
aggggcaatgccccgacagctgccgatgtcgctgttccgccggagttgcgtaagcatccc
cgacggaccaacagtggcctgcagccttccggcgtatctggggcgcgccctccgccctgt
cttttacggcagtctgagcggaaggtcaattttgtcgacaatcttgtggacactgcctcc
atgatcgtcgaaaccatctggcctttatccgcggtctcactgcggagtgattcagctaca
ggatgcaagggtgtcttgcctctgcgtacctttattcaagaaacactccgccggtcgcgg
acgagctacagcacgttgcaggtagcgctctactacttgatcaagatcaaggcgcacgtg
ccaagttcagaacagacgcaggatcagtcgcgatcgagaccagtctgccgggccatgcag
tgtggccgacgcatgttcttagctgctttgatccttgcctcaaaatatcttcaggaccgg
aactattccgctcgtgcctggagcaagatttctggtctgaacacagcagaaatcaaccaa
aatgaactgctattcctggaagctgttgactggaaacttcacattaccgaagcgaccttc
caacgctggacagacattgtcctgaagtacaccccgggtgccggtaacatgttccccgtc
aatgggcagtcatggcgtactgtcatccctcggctgactcctgagttggacgaaatcgac
agtgagcctatgactcctacgagtgtgggaggatacgatagtagttttgcgtcaaattcc
ccgtcgcctcgcagcacctgcgcgcggccaccgatctacccctcggtgaatgtcgagcct
actgcgcttccttctatctctcagatctcggaaccatcccgtccggacagcactattcca
cccctaccgtcgctaccccgtctccctctgctgccgacccctcagttgactccgcaaacg
agcaatgcttccactcctgctgtgagtgctggctgccgcccctcttaccgacgtcaaatg
tgtgctgctatgtctcagagcatgtgcacggcgcggtcaatgtatgaccagcggccgtcg
ttgtgctcaaaggctagcagcgcactggaagggttccccacatttatgcgtcggtcgtcc
ctggctcgttcgacgtcatctgcatcgtcaccagagtcgatggtttcggatgtttcaacg
ctgtcctctcagtcatcccgctcttccttctctagcgcgtctgggacttctgcgcctact
ttgcctagcctagcaatgcaggcgaccctccgatgcacaggcaactcattcaaaggaact
cggaaacacatgccgatggcctcgccaatagatgagataactttcagcggatcaaattcc
ccggaaggctacctgggctcgaccagccgtgctccggatatgtccagcttctctatggaa
actccggtggacgtgacctccgcccgcgaggctgctcagagcctgtgccaactgtcgggt
cagaagtctactggtcaagggcaaaggcggcaatgccgcaaacgtggccggactgggtcc
gacgacctgctgctacagcaacatgtgcgcagcctcatccgctccgacactctagctgaa
ggaacagtacttccggatggcaacatggcagagctgcttcggatgtcgcagcctgacaac
acttctccctcactcccatcgctgagcgcccttgggttaggtgcgcccttgtctggccca
gctggaatgaagcgtgcttgctgcggtagcgaagcaagaaaaattgcactccaccctagc
ttgcgcgtcgactactga

DBGET integrated database retrieval system