KEGG   Asparagus officinalis (garden asparagus): 109833799
Entry
109833799         CDS       T05243                                 

Name
(RefSeq) octaketide synthase 3-like
  KO
K21385  5,7-dihydroxy-2-methylchromone synthase [EC:2.3.1.216]
Organism
aof  Asparagus officinalis (garden asparagus)
Brite
KEGG Orthology (KO) [BR:aof00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:aof01008]
    109833799
Enzymes [BR:aof01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.216  5,7-dihydroxy-2-methylchromone synthase
     109833799
Polyketide biosynthesis proteins [BR:aof01008]
 Polyketide synthase (PKS)
  Type III PKS
   Plant type
    109833799
SSDB
Motif
Pfam: Chal_sti_synt_N Chal_sti_synt_C ACP_syn_III_C ACP_syn_III FAE1_CUT1_RppA
Other DBs
NCBI-GeneID: 109833799
NCBI-ProteinID: XP_020257203
Position
3
AA seq 396 aa
MAATSMMENVENIRKAQRADGMATIMAIGTSHPPHAIEQNNFADFYFRVTNSEDKVDLKN
KFDRICRKTMIKKRYFYHNEEFLKKYPNICSFSAPSLNDRQDICVPEVPKLGKQAALKAL
EEWGRDKSLITHVIMCTSCGVDMPGADFQLVKLLGLNLNINRYMVYMQGCYAGGTVLRYA
KDLAENNRGARVLVVCAELTIIGIRGPNETHIDNGIGNSLFGDGAAALIVGSDPIKGVEK
PIFEIVSVKQRIIPDSEGVIQLHLREEGLTFHLTKDSPDLIANNIEQCLTDAFEPVGLPS
DWNSLFWIPHPGGRAILDEVEAKLNLHPEKFRATRHVLWEYGNMISACVLYILDEMRKRS
LAEGLATTGEGLEWGVLLGFGPGMTVETIVLHSVPI
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggctgcaacatcaatgatggagaatgttgaaaatatccgtaaggcacaaagagctgat
ggaatggcaaccatcatggccattggaacatcacatcctccccacgccattgaacagaac
aacttcgcggacttctattttcgggtaactaacagtgaggacaaggtcgatctaaagaac
aagtttgaccgcatttgcagaaaaacaatgattaaaaagcggtatttctaccacaacgag
gagttcttaaagaagtatccaaacatatgttcgttcagtgcaccatccctcaatgaccgc
caggacatttgtgtgcctgaagtaccgaagcttggcaaacaagcggcactcaaagcacta
gaagaatggggaagggataaatctctaattacccacgtaataatgtgcacctcctgtggt
gttgacatgccaggcgctgacttccaactcgtcaaactccttggcttgaatctcaacatc
aaccgttacatggtctacatgcaaggctgctatgctggtggcactgttctccgttatgca
aaggacttggctgaaaacaaccggggtgcaagagtacttgtcgtgtgtgcagagctgact
ataattggtatccgcggtcccaacgagacccatatcgataatggcataggaaactcgttg
ttcggggatggggcggcagcgttgattgtcggttcagacccgataaaaggtgttgagaaa
cctatattcgagattgtatcagtgaaacaaaggataattcctgatagtgaaggggtgatc
caacttcacctcagggaggaaggcctaactttccacctgaccaaggacagccctgacctg
atagcaaacaatatagagcagtgcctaactgatgcttttgagcccgtggggttaccctcc
gattggaactcgctgttctggattccacacccaggtggtcgggcaatactggatgaagtg
gaggcgaagttgaaccttcatcctgaaaagtttcgagcaacacgacatgtgttatgggaa
tacgggaacatgatcagtgcctgtgtgctctacatactggatgagatgaggaagaggtct
ttggcggaggggctagcaacaactggggagggacttgaatggggtgtgttgctgggtttt
gggcctggcatgacggttgaaaccatagtgcttcacagtgtgcctatatag

DBGET integrated database retrieval system