KEGG   Aspergillus oryzae: AO090120000002
Entry
AO090120000002    CDS       T01018                                 

Name
(RefSeq) unnamed protein product; voltage-gated shaker-like K+ channel, subunit beta/KCNAB
  KO
K17647  versiconal hemiacetal acetate reductase [EC:1.1.1.353]
Organism
aor  Aspergillus oryzae
Pathway
aor00254  Aflatoxin biosynthesis
aor01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aor00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    AO090120000002
Enzymes [BR:aor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.353  versiconal hemiacetal acetate reductase
     AO090120000002
SSDB
Motif
Pfam: Aldo_ket_red CNPase
Other DBs
NCBI-GeneID: 5996034
NCBI-ProteinID: XP_023092383
Position
5:complement(2696550..2697787)
AA seq 343 aa
MEYARLGDSGLKVSKVILGCMGYGTPEWQGWVLNEEESLPLIEHAYNKGIRTWDTADMYS
HGKSEEIVGKALKKYNIPRSRVVILTKCYFGVDDQGNFPSPLSTGRQNAGDYLNRVGLSR
RHILEAVDASVERLGTYIDVLQIHRLDRETPREEIMRALNEVVESGKVRYIGASSMAAWE
FQTLQNIAIRNGWHKFISMQNYHNLIAREEEREMIPYCLDSGVSLIPWSPVARGALARPW
ASRSTLRENTDAGISILVRARESASDKAIIDRVEELAGKKGISMAQVAIAWSLSHPSEYP
IVGLNTKDRIDEAVASVQVKLTPEEIQYLEEPYVPKAIHPGER
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggaatacgcacggctgggagattcgggcctcaaggtctcaaaggtgatactgggttgt
atgggatacggcaccccagaatggcagggctgggtgctaaatgaagaagaatctcttcca
cttattgaacacgcctacaacaaaggcatcagaacctgggatactgccgatatgtactcc
catggcaaatccgaagaaatcgtgggaaaggctctgaagaagtacaacatcccccgttct
cgagtggtaatattgaccaaatgttactttggtgtggatgatcaggggaactttccctcc
cctctttcgaccgggagacagaacgctggtgactacttgaatcgcgtcggtctttctcgc
agacacatcttggaggccgttgatgccagtgttgagcgactaggaacttatattgacgtc
cttcaaattcaccgacttgatcgggagacgccacgcgaggagatcatgagagcgctgaat
gaggtagtggagagtggcaaggttcgatacatcggcgctagttcgatggccgcctgggaa
ttccagaccctacaaaatattgccattcgcaatggctggcacaagtttatctccatgcag
aactaccacaatctcattgcccgtgaagaggaacgtgaaatgatcccttactgccttgac
agcggcgtatctcttatcccgtggtctcctgtcgcacgtggagccctcgccaggccttgg
gcttctcgctctaccttgcgtgaaaacacggatgctgggataagtattctcgttcgtgcc
cgcgagtccgcgtccgacaaagctattattgaccgcgtggaagaattggctggcaagaag
ggaatcagcatggcacaagttgcaatcgcatggtcactgagtcaccctagcgagtaccct
attgtcgggctgaacactaaggatcgcattgatgaggctgttgcgagtgtccaggtcaag
ctgactcccgaagagatccagtaccttgaagagccctatgtccctaaggctatccatcct
ggggaacgataa

DBGET integrated database retrieval system